KEGG   Danio rerio (zebrafish): 569769Help
Entry
569769            CDS       T01004                                 

Gene name
pomt1, zPOMT1, zgc:153731
Definition
protein-O-mannosyltransferase 1 (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dre  Danio rerio (zebrafish)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:dre00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 720 aa AA seqDB search
MQCVKLPVSVTVEINVLLLAVTALALFTRLYGIHFPKAVVFDEVYYGQFLSLYMKQVFFI
DESGPPFGHMILALGAYLGGFDGNFVWNRIGAEYPGNVPVWSLRLIPALAGSFCVPLAYL
VVVELGYSHFSALGACALLLMEDSLIVQSRFMLLESVLIFFLLLAVLSYLRFHKARNSSF
KWFWLVICGVSCAFGIGVKYMGMFTYFLLLSQAAVHTWQLIGDRTLSHGKVMFHVLVRFL
ALVVLPVIMYLGFFYIHLTLLYRSGPHDQMMSSAFQASLEGGLARITQGQPLDVAFGSQV
TLRTVSGKPVPCWLHSHKANYPIRYENGRGSSHQQQVTCYPFKDVNNWWIIKDPGRQSLV
VSSPPRPVRRGDIIQLLHGMTTRYLNTHDVAAPMSPHSQEVSGYIDFNVSMPAQNLWRVD
IVNRESEKEIWKTILSEVRLVHVNTSAVLKLSGASLPEWGFKQLEVVGDKIYKGYQQTGM
WNVEEHRYGRSQEPKERELELKSPTHSDVNKNLTFMAKFLELQWKMLTVKNEESEHKYSS
SPLEWITMDTNIAYWLHPSSNAQIHFIGNIVTWTTGNITLVVYCLLFLTYLIRRRRKVED
IPQDSWEQLVLAGVVCFGGWAVNYLPFFLMEKTLFLYHYLPALTFKILQIPIVTEHLYIH
VLRSSAQQKAFGGVILAVLCSVYMSYHSLSPLTYGQPALTSDKLAELRWRESWDILLRKR
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgtgttaaactgcccgtcagtgtgacagtggagataaatgtgctgctgctggcg
gttacagcacttgccctctttactcgactttatggcattcactttcccaaagctgtagtg
tttgatgaggtttattatggacagttcctgtcattgtacatgaagcaggtttttttcata
gatgaaagcggtcctccttttggacacatgatacttgctttaggagcgtatttaggagga
tttgatggcaactttgtttggaacagaattggagcagaataccctggtaatgtccctgtt
tggagccttcgactgataccggctctggcaggctctttttgtgtgccacttgcatatctt
gtagtagtggagctgggatactctcacttctcggcactgggggcctgtgcgcttctcctc
atggaagactccctgattgtgcaatcgcgcttcatgctgctggagtctgttttaattttc
ttcttgctgttggctgtgctgtcttacctccgctttcacaaagcacgcaactcatctttc
aagtggttttggcttgtgatctgtggggtcagctgtgcatttggaattggagtaaagtac
atgggtatgttcacatactttctactgctgagccaggcagctgtacacacctggcagctt
attggagatcgaaccttgagccatggcaaagtaatgttccacgtattggttcgcttcctg
gcactcgtggtgctacctgtcatcatgtaccttgggtttttctacattcatctgaccttg
ctatatcgcagtggacctcatgaccagatgatgagcagtgcctttcaagcaagtctcgag
ggtggtcttgcccggatcactcaggggcagcctttagatgtagcatttggctcacaggtc
actctccgcacagtctccggtaaacctgtgccttgttggcttcactcacacaaggccaac
tatcccatcaggtatgaaaatggccgtggaagctcccaccagcagcaggtgacctgctat
cctttcaaagatgtcaacaactggtggattatcaaagaccctgggcggcaaagtcttgtg
gtcagcagcccacccagacctgtcagacgtggggatattattcagttgctgcatggaatg
acaactcgctacctgaacacacatgatgttgcagcccccatgagtcctcactcacaggaa
gtgtcgggctatattgattttaacgtgtctatgccagctcagaatctctggagagtggat
attgtgaacagggagtctgagaaagagatctggaagaccattttatcagaggtgcgacta
gtccacgtgaacacctcagctgttttaaagctcagtggagcctctctgccagagtggggt
tttaaacagctggaggtggtgggtgataagatttataaaggctaccagcagaccggcatg
tggaacgtggaggagcaccgctatggcagaagtcaggaaccaaaggaaagggagttggag
ctgaagtctcctactcacagcgatgtcaacaaaaatctcacatttatggccaaatttctg
gaactgcagtggaagatgctgacagtaaagaacgaagagtcagagcacaaatatagttca
tcacctcttgaatggatcacaatggacaccaacattgcatattggcttcatccttcaagt
aatgcacagattcactttataggcaatattgttacttggaccactggaaacattacactg
gttgtgtactgtcttctgtttttaacatacttaataagacggaggaggaaagttgaagac
attccacaagactcttgggaacagttggttttggctggtgtggtttgctttggaggctgg
gcagtgaattacctgccattcttcctaatggagaagactctctttctatatcactatctc
ccagcactcaccttcaagatcttgcaaatacctatagtcacagagcacctgtacatccac
gtattgagatcctcagctcaacagaaagcatttggtggtgtgattttagcagttctttgt
tcagtatacatgtcctaccacagcttgagtcctctcacgtatggccagccagcgttaaca
tcagacaagctcgctgagctgcgctggagggagagttgggatattctcttacgcaaacgc
taa

DBGET integrated database retrieval system