KEGG   Danio rerio (zebrafish): 570106Help
Entry
570106            CDS       T01004                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, liver type-like
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    570106
   01230 Biosynthesis of amino acids
    570106
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    570106
   00030 Pentose phosphate pathway
    570106
   00051 Fructose and mannose metabolism
    570106
   00052 Galactose metabolism
    570106
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    570106
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     570106
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     570106
Messenger RNA biogenesis [BR:dre03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     570106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 780 aa AA seqDB search
MSSAGLEKLRMTGAGRAIAALTSGGDAQGMNAAIRAVTRMGIYVGAKVYLVYEGYQGLVD
GGDNIKLANWQSVTNIIQLGGTVIGSARCKAFTMREGRLAAAFNLVKRGISNLCVCGGDG
SLTGANIFRAEWSGLLEELVQKGRITAETAQKHGHLNIVGLVGSIDNDFCGTDMTIGADS
ALNRITEIIDAITTTATSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
ELMCARLEESRSKGCRLNIIIIAEGAISRSGEAITSNYIKDLVVSRLGYDTRVTVLGHVQ
RGGTPSAFDRVLSSKLGVEAVVALLEATPDTPACVIGLSGNQAVRLPLVEAVEMTKEVQR
AMNEKRFEEAIQLRGRSFENNWSIYKLLAYQKSAAVQSEHSIAILNVGAPAAGMNAAVRS
AVRVALASGHRVYIVNDGFEGLAKGAVNEVSWNQVAGWTGLGGSLLGTKRTLPSTCMDKL
VENLNKFSIHSLLVIGGFEAYEGVLELVEARGRYDELCIPMCIIPATISNNVPGTEFSLG
SDTAVNAAMSSCDKIKQSASGTKRRVFVVETMGGYCGYLATTTSIAVGADAAYIFEDPFN
IHDLTTNVVHLTEKMKKDIQRGLVLRNEKCHEHYTTDFIHKLYSAEGKGVFDCRVNILGH
LQQGGVPTPFDRNYGTKLGVRAVQWLTEKMNDSFRQGRVFANTPDTACVVGLYKKAMTFS
PVTELKEQTDFEHRMPKTQWWLNLRLMLKMLAKYQTSFNEYVTGEIEHVTRRSLSIDTGF
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgagttcagccgggctggagaagctgcggatgaccggcgcgggaagagccatcgccgcg
ttaacgagcggaggagacgcgcaaggtatgaacgcagccatccgcgctgtgacacgaatg
ggcatctatgtaggcgccaaggtctatctggtgtacgagggttatcaagggctggtggat
ggaggagacaacattaaactggccaactggcagagcgtcaccaatataatccagctggga
ggaacagtgattggcagtgcccgctgtaaagcattcaccatgcgtgagggccggttagcg
gcagcatttaacctggtgaagcgtggcatctctaacctgtgtgtgtgtggaggagacggc
agcctcaccggagcaaacatcttcagggccgagtggagcggactcctggaagagctcgtc
cagaaaggtcgtatcacagcagagactgcgcagaagcacgggcacctgaacatcgtgggt
ctggtgggctccattgataatgatttctgtggcacagacatgacgatcggtgctgattct
gctctcaaccgcatcactgagatcatcgatgccatcaccaccactgcaaccagccatcag
cgcacattcgtgctggaggtgatgggccgtcactgcgggtatctggcactggtttcagct
ctggcctctggagctgattggctgtttatcccagaagcccctcctgaggacggatgggaa
gagctcatgtgtgctcgcctggaagagagccgcagtaaaggatgcagactgaacatcatc
atcattgctgaaggagccataagcagaagtggagaagccataacctccaactatatcaaa
gacctggttgtgtcgcggctgggttacgacacgcgggtcactgttctgggtcacgtgcag
cgcggtggcacaccgtctgccttcgacagagtgctgagcagtaagctgggtgtggaggcc
gttgtggctctgctggaagcaactccagacactcctgcatgtgtgatcggcctgtcggga
aaccaggctgtgcggctgccgctcgtggaggcggtggagatgactaaagaggttcagaga
gccatgaatgagaagcgcttcgaagaggccattcagttacgtggcaggagctttgagaac
aactggagcatttataagctgctggcatatcagaaatctgctgcggttcagagtgaacac
tccattgccatcctgaatgttggtgctccagcggcaggcatgaatgcagcggttcgctct
gctgtgagagtggctctggccagtggacaccgcgtttacatcgtcaacgatggctttgag
gggctggccaaaggagcggtgaatgaagtgtcctggaatcaggtggccggttggacaggt
ctgggtggctctttgctgggaactaaacgaaccctccccagcacctgcatggacaaactg
gtggaaaacctcaacaagttcagcatccactcgctgctggtcatcggtggtttcgaggcg
tatgaaggtgttctggagctggtggaagcaagaggtcgctatgatgaactgtgtattccc
atgtgcatcatccctgccaccatcagcaacaatgtgccaggaactgagttcagtctgggc
agcgatactgctgttaatgcagccatgtctagctgtgataagatcaagcagtcagcctcg
ggaaccaagaggagagtgttcgtagtggagactatgggtggatattgtggttatctggca
accaccactagcattgctgtcggtgcggatgctgcgtacatatttgaagatccttttaac
atccatgacctcacgaccaatgtggtgcatttgacagagaaaatgaagaaggacattcag
agagggctggtgctgaggaacgagaagtgtcatgagcactacaccactgatttcatccat
aagctttactccgccgaggggaaaggtgtgtttgactgcagagttaatatcctgggacat
ctgcagcagggtggagttcctactccctttgacagaaactatgggactaaactgggtgtt
cgagctgtacagtggctgacagagaagatgaacgacagcttcagacaaggtcgtgtgttt
gcgaacactcctgacacagcctgtgtggtgggcctgtataagaaggctatgaccttcagt
cccgtcactgagctgaaggaacagaccgactttgaacaccgaatgcccaagacacagtgg
tggctaaatctgcgtctgatgctgaagatgttggcaaagtaccagacatccttcaatgag
tatgtgacgggagagatcgaacatgtgacccggcgctcgctcagcatcgacactggcttc
taa

DBGET integrated database retrieval system