KEGG   Danio rerio (zebrafish): 570106Help
Entry
570106            CDS       T01004                                 

Gene name
pfkla
Definition
(RefSeq) phosphofructokinase, liver a
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    570106 (pfkla)
   01230 Biosynthesis of amino acids
    570106 (pfkla)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    570106 (pfkla)
   00030 Pentose phosphate pathway
    570106 (pfkla)
   00051 Fructose and mannose metabolism
    570106 (pfkla)
   00052 Galactose metabolism
    570106 (pfkla)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    570106 (pfkla)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     570106 (pfkla)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     570106 (pfkla)
Messenger RNA biogenesis [BR:dre03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     570106 (pfkla)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
9
AA seq 780 aa AA seqDB search
MSSAGLEKLRMTGAGRAIAALTSGGDAQGMNAAIRAVTRMGIYVGAKVYLVYEGYQGLVD
GGDNIKLANWQSVTNIIQLGGTVIGSARCKAFTMREGRLAAAFNLVKRGISNLCVCGGDG
SLTGANIFRAEWSGLLEELVQKGRITAETAQKHGHLNIVGLVGSIDNDFCGTDMTIGADS
ALNRITEIIDAITTTATSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
ELMCARLEESRSKGCRLNIIIIAEGAISRSGEAITSNYIKDLVVSRLGYDTRVTVLGHVQ
RGGTPSAFDRVLSSKLGVEAVVALLEATPDTPACVIGLSGNQAVRLPLVEAVEMTKEVQR
AMNEKRFEEAIQLRGRSFENNWSIYKLLAYQKSAAVQSEHSIAILNVGAPAAGMNAAVRS
AVRVALASGHRVYIVNDGFEGLAKGAVNEVSWNQVAGWTGLGGSLLGTKRTLPSTCMDKL
VENLNKFSIHSLLVIGGFEAYEGVLELVEARGRYDELCIPMCIIPATISNNVPGTEFSLG
SDTAVNAAMSSCDKIKQSASGTKRRVFVVETMGGYCGYLATTTSIAVGADAAYIFEDPFN
IHDLTTNVVHLTEKMKKDIQRGLVLRNEKCHEHYTTDFIHKLYSAEGKGVFDCRVNILGH
LQQGGVPTPFDRNYGTKLGVRAVQWLTEKMNDSFRQGRVFANTPDTACVVGLYKKAMTFS
PVTELKEQTDFEHRMPKTQWWLNLRLMLKMLAKYQTSFNEYVTGEIEHVTRRSLSIDTGF
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgagttcagccgggctggagaagctgcggatgaccggcgcgggaagagccatcgccgcg
ttaacgagcggaggagacgcgcaaggtatgaacgcagccatccgcgctgtgacacgaatg
ggcatctatgtaggcgccaaggtctatctggtgtacgagggttatcaagggctggtggat
ggaggagacaacattaaactggccaactggcagagcgtcaccaatataatccagctggga
ggaacagtgattggcagtgcccgctgtaaagcattcaccatgcgtgagggccggttagcg
gcagcatttaacctggtgaagcgtggcatctctaacctgtgtgtgtgtggaggagacggc
agcctcaccggagcaaacatcttcagggccgagtggagcggactcctggaagagctcgtc
cagaaaggtcgtatcacagcagagactgcgcagaagcacgggcacctgaacatcgtgggt
ctggtgggctccattgataatgatttctgtggcacagacatgacgatcggtgctgattct
gctctcaaccgcatcactgagatcatcgatgccatcaccaccactgcaaccagccatcag
cgcacattcgtgctggaggtgatgggccgtcactgcgggtatctggcactggtttcagct
ctggcctctggagctgattggctgtttatcccagaagcccctcctgaggacggatgggaa
gagctcatgtgtgctcgcctggaagagagccgcagtaaaggatgcagactgaacatcatc
atcattgctgaaggagccataagcagaagtggagaagccataacctccaactatatcaaa
gacctggttgtgtcgcggctgggttacgacacgcgggtcactgttctgggtcacgtgcag
cgcggtggcacaccgtctgccttcgacagagtgctgagcagtaagctgggtgtggaggcc
gttgtggctctgctggaagcaactccagacactcctgcatgtgtgatcggcctgtcggga
aaccaggctgtgcggctgccgctcgtggaggcggtggagatgactaaagaggttcagaga
gccatgaatgagaagcgcttcgaagaggccattcagttacgtggcaggagctttgagaac
aactggagcatttataagctgctggcatatcagaaatctgctgcggttcagagtgaacac
tccattgccatcctgaatgttggtgctccagcggcaggcatgaatgcagcggttcgctct
gctgtgagagtggctctggccagtggacaccgcgtttacatcgtcaacgatggctttgag
gggctggccaaaggagcggtgaatgaagtgtcctggaatcaggtggccggttggacaggt
ctgggtggctctttgctgggaactaaacgaaccctccccagcacctgcatggacaaactg
gtggaaaacctcaacaagttcagcatccactcgctgctggtcatcggtggtttcgaggcg
tatgaaggtgttctggagctggtggaagcaagaggtcgctatgatgaactgtgtattccc
atgtgcatcatccctgccaccatcagcaacaatgtgccaggaactgagttcagtctgggc
agcgatactgctgttaatgcagccatgtctagctgtgataagatcaagcagtcagcctcg
ggaaccaagaggagagtgttcgtagtggagactatgggtggatattgtggttatctggca
accaccactagcattgctgtcggtgcggatgctgcgtacatatttgaagatccttttaac
atccatgacctcacgaccaatgtggtgcatttgacagagaaaatgaagaaggacattcag
agagggctggtgctgaggaacgagaagtgtcatgagcactacaccactgatttcatccat
aagctttactccgccgaggggaaaggtgtgtttgactgcagagttaatatcctgggacat
ctgcagcagggtggagttcctactccctttgacagaaactatgggactaaactgggtgtt
cgagctgtacagtggctgacagagaagatgaacgacagcttcagacaaggtcgtgtgttt
gcgaacactcctgacacagcctgtgtggtgggcctgtataagaaggctatgaccttcagt
cccgtcactgagctgaaggaacagaccgactttgaacaccgaatgcccaagacacagtgg
tggctaaatctgcgtctgatgctgaagatgttggcaaagtaccagacatccttcaatgag
tatgtgacgggagagatcgaacatgtgacccggcgctcgctcagcatcgacactggcttc
taa

DBGET integrated database retrieval system