KEGG   Danio rerio (zebrafish): 570288Help
Entry
570288            CDS       T01004                                 

Gene name
flncb, im:7139256, wu:fc02d03
Definition
filamin C, gamma b (actin binding protein 280)
Orthology
K04437  
filamin
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    570288 (flncb)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    570288 (flncb)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    570288 (flncb)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   570288 (flncb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
4
AA seq 2773 aa AA seqDB search
MMSNNTYYDQQLPPQYYQGTDNGEDGDEEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLK
CLNRKILDLQKDLTDGLKLIGLLEVLSQKKMYRKYHARPNFRQMKLENVSVALEFLEREH
IKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKLTPKQRLLGWIQN
KVPQLHINNFHRDWRDGKALGALVDNCAPGLCPDWETWDPSQPVENAREAMQQADDWLGV
PQVIAPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKTLHPKRAKAYGPGIEPRGNV
VLKPAEFVVETVEAGLGEVLVYIEDPEGHTEEARVIPNNDRNRSYSVVYVPKVEGLHKVK
VLFAGQDIDRSPFLVNVSKALGDPNKVQARGPGLEPVGNVANKPTYFDIYTAGAGAGDVG
VIIVDSQGRRDTVEIILENKGDSVFRCTYGPILEGPHTIYVTFAGQQIPRSPFTVHISEA
PPHGRQIGSPVHIIPQSLRTPPSEKAKKVPPPTPPKPRRPTSNPNACRAIGRGLQPKGVR
VKEVADFKVYTKGAGSGELRVHVKGPTGGDEPVKVEDLGDGVYECDYYPIFCGKYIITVT
WGGHAIPRSPFEVIISEDAGPQKVRAWGPGLETGMVGKSADFVVEAIGTEVGTLGFSIEG
PSQAKIECDDKGDGSCDVLYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAASDVFPEKV
KCYGPGLEPTGCIVNKPAEFTIDARGAGRGQLQIYAQDSEGFPINIQITDNGDSTYFCVY
IPIKPIKHTIIITWGEVNVPNSPFRVTIGEGSHPENVKVHGPGVEKTGLKANEPTYFTVD
CSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGRYTIMVLFADQ
EIPISPFRIKVDPSHDANKVKAEGPGLNKTGVEVGKPTHFTIYTKGAGKATPEVHFTASG
RGDAVSDFEIIDNHDYSFTVRYTALQQGNMTISVCHGGDPIPKSPFTISVAPPLDLNKVK
VHGLNNKVDVGKDEEFTVNTRGAGGQGKVDVKITSPSRRPIPCKVESGASNEVHTVKYIP
PEEGPYKVDISYDGNPVPGSPFTVEGVMPPDPSKVRAYGPGLKGGIVGKPAPFAIDTKGA
GTGGLGLTVEGPCEAKIECQDNGDGSCSVSYLPTEPGEYSINILFADAHIPGSPFKAMVQ
SVFDPSKVTASGPGLERGKVNEAGSFTVDCSKAGEAELTIEIISDSGAQAEVHVQNNSDG
TYSITYIPPFHGMYTITIKYGGHAVPKFPARVQVDPALDTSGIKVYGPGVEPRGVLREVT
THFIVDTRVHNKMGGNHIKVRIVNPSGANTDAYVTDKADGTYRVEYTAYEDGVHLIEVLY
DDVPVPKSPFRVAVAEGCDPSRVRAYGPGLEEGLVNKPNRFTVETRGAGTGGLGLAIEGP
SEAKMSCKDNKDGSCSVEYIPFTPGEYDVNITFGGLPIPGSPFRVPVRELVDPSKVKCTG
PGLGSGVRAHVPQTFTVDCSKAGLAPLEVLLYGPTGMTEPVNITDNGDGTHTVVYTPAKD
GPYTVCVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGVPASLPVEFTIDARDAG
EGLLTVQILDPEGKPKKANIRDNRDGTYTVSYVPDMTGRYTITIKYGGDEIPYSPYRIHA
LPSGDASKCLVTVSIGGHGLGSGLGPTIQIGEETVITVDAKAAGKGKVTCKVSTPDGAEL
DVDVVENADGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVASDTIPIIEEPCDKLQL
QQPYAPYQGYSPHWATEEPVTAVDIIEPVLRPFNLVIPFTVQKGEITGEVHMPSGKTASP
HITDNKDGTVTVKYAPTEKGLHEMDIKYDGNHIPGSPLQFYVDAINSGHVNAYGPGLSHG
MVNKSATFTIVTKDAGEGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTAPGDYNIIVKF
DDKHIAGSPFTAKITGDDSMRTSQLNVGTATDVSLKITETDLSSLSATIRAPSGNEEPCL
LKRLPNRHIGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGQSEIGDASKVKVSGKGLI
EGHTFEVAEFIVDTRSAGYGGLGLSIEGPSKVDINCSDVDDGTCKVTYCPTEPGTYIINI
KFADQHVPGSPFTVKVLGEGRMKESITRKRQAPSIATVGSTCDLNLKIPGNWFQMVSAQE
RLTRTFTRSSHTYTRTERTEISKTRAGETKREVRVEESTQVGGDPFRDVFGGFMGRESLG
PFNSPQGRQSEGESGTQEMTAQVTSPSGNTEDAEIIEGEDSTYSVRFVPHEMGPHTVNVK
YRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLDRGVAGVPAEFSIWTREAGAGGLSIAV
EGPSKAEISFEDRKDGSCGVAYIVQEPGDYEVSIKFNDEHIPDSPFIVPIASLSDDARLL
TVTSLQEMGLKVNQEASFAVQLNGARGAIDAKVHTPSGAVEECYITELDNDKHAIRFIPR
ENGVHSIDVRFNGSHIPGSPFKIRVGEPGQAGDPGMVTAFGPGLEGGTTGVPSDFIVNTC
NAGSGALSVTIDGPSKVKMDCQECPEGYKVTYTPMAPGSYLISIKYGGPQHIVGSPFKAK
VSGARLSGGHSLHETSSVLVETVTKSSSVAGSFSTLPKFSSDASKVVSRGAGLSKAFIGQ
KNTFTVDCSKAGTNMLMVGVHGPKTPCEEVYVKHMGNRMYNVTYTVKEKGDYILIVKWGE
EMVPGSPFHVTVP
NT seq 8322 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcaataatacatactacgaccagcagctgccgccgcagtattaccagggcacc
gacaacggcgaggacggagacgaggagatgccggccacggagaaggacctggccgaggat
gcgccctggaagaagatccagcagaacaccttcaccaggtggtgcaacgaacacctgaaa
tgcctcaacagaaagatcctggatctgcagaaggacctgaccgacgggctcaagctcatc
gggctcctggaagttctcagccagaagaaaatgtacagaaagtaccacgccagacccaat
ttcaggcagatgaagctggagaatgtgtcagtggcgctggagtttctggaaagggaacac
atcaaactggtttcaatagatagtaaagctatagtggacggcaacctaaaactgatcctg
gggctgatatggacccttatcctgcactactccatttccatgcccatgtgggaggacgag
gacgatgaagacgccagaaagctgacgcccaaacagcgcctcctgggctggatccagaat
aaagtcccccagttgcacatcaacaacttccacagggactggagagatggcaaagccctc
ggtgcattggtggataactgcgcaccaggcctgtgtccggactgggaaacatgggatccg
agtcagcctgtggaaaatgcaagagaagccatgcagcaagccgacgattggcttggtgtg
cctcaggtcattgctccagaggagattgtggatcctaatgtggacgagcattcggtgatg
acctacctgtcgcagttccccaaagccaaactcaagcctggtgcaccactgcgacccaaa
actctgcaccccaagagagccaaggcctacggaccaggtattgagcccagagggaacgtt
gtgttgaagccagccgagtttgtggtggagaccgtggaggccgggcttggagaggtgttg
gtctacattgaagatccagagggacacacagaagaggctagagtaattcccaacaatgac
aggaacaggagttactctgtggtgtatgttccgaaagtggagggtttgcataaggtgaaa
gttttgtttgctggacaggacattgacagaagccctttcttagtaaatgtgtctaaagca
ctgggagacccaaacaaggtgcaggccagagggccaggtttggaaccggtgggcaacgtg
gccaataaacccacctattttgacatctacactgcaggtgcaggagcaggtgatgttggt
gtgatcattgtggactctcagggccgtagagacacagtggagatcattctggaaaacaag
ggtgacagtgttttccgttgcacctatggccccattctggagggccctcacactatatat
gtgacattcgccggccagcaaatacccagaagtcctttcactgtgcacatctcagaggct
cctccacatggccggcagatcggctccccggttcacataatcccccagtctttacgcacg
ccgccctcagaaaaggccaagaaagtgcctcccccaacaccacccaaacccaggcgacca
acaagtaaccccaatgcttgtcgggcaattggtcgtggcctgcagcccaagggtgtacgt
gtgaaggaggtggctgattttaaggtttacacgaagggagcaggcagtggagaactacgt
gttcatgtcaaggggccaacaggtggcgatgagcctgtgaaggtggaagatttgggagac
ggtgtgtatgaatgtgattactatcctattttctgtggaaaatacatcatcaccgttact
tggggtggccatgccattccccgcagtccatttgaggtgatcataagtgaagatgcagga
cctcagaaggtgagggcatggggtccaggcttggagacgggcatggtgggcaaatcagct
gattttgtggttgaagccattggcacagaggttggaactctgggcttttccatcgaaggg
ccctcgcaggctaagatagagtgtgatgacaagggtgatggctcttgtgatgttttgtac
tggcccactgagccaggggactatgcagtccatgtcatctgcgatgatgaagatattaaa
gacagcccctttatggcccacatcctccctgcagccagtgacgttttccctgagaaggtt
aagtgttacggccccgggctggagccaaccgggtgcatcgtaaataaacctgcagagttt
acaattgatgcccgtggagctggaagaggacagctacaaatttatgctcaggactcagaa
gggtttcccatcaacatccagatcacagataacggcgacagcacatatttctgcgtctat
atacccatcaagcccatcaaacacactatcatcatcacatggggagaggtcaacgttccc
aacagtcctttcagggtgaccattggagaaggcagtcaccctgagaatgtgaaggttcat
ggaccaggagtagaaaagactggcttaaaggccaacgaacccacatacttcacagtggac
tgcagtgaggctggacagggagatgtaagcattgggattaagtgcgctcctggtgtggtg
ggacctgcggaagcagatattgattttgacatcattaaaaatgacaatgacacattcaca
gtgaagtatacaccccctggtgctggacgctacacaatcatggtgctatttgcagatcaa
gaaattcccatcagccccttccgtatcaaagttgatccatctcatgatgctaataaggtc
aaagcagagggtcctggcctcaacaagacaggtgtggaagtgggcaagccaacccacttt
acaatctacactaaaggagcaggcaaggccacacctgaggttcacttcactgcatctggt
agaggagatgctgtcagtgactttgagatcatcgataaccatgactattctttcactgtg
cgctacactgcattacagcaggggaacatgactatatctgtgtgccatggtggtgacccc
attcccaaaagcccatttaccatctccgttgctcctcctttagacctcaacaaggtcaaa
gtccatggactcaacaataaagtggatgtcgggaaggatgaggagtttactgttaataca
cgtggtgcgggaggtcaaggaaaggtggacgtcaagattacctcaccctctcgtcggcca
atcccgtgcaaggtggaatctggcgcgtccaatgaggtgcacactgttaagtacattcct
ccagaggaggggccctacaaagtggacatcagctatgatggaaaccctgtgccaggaagc
cctttcacagtggagggggtgatgcctccagatccctcaaaggtacgggcttatgggcct
ggtttgaagggaggcattgtgggtaagccggctccatttgccatcgacaccaaaggtgct
ggcacaggtggtctcggtctgactgtggaaggcccatgcgaagccaaaatcgagtgccag
gacaatggagatggatcttgctctgtgtcttatctgccaaccgaacctggagagtattcc
atcaacatcctgtttgctgatgctcatatcccaggttccccatttaaagctatggtgcag
tccgtctttgacccaagcaaggtcacagctagtggaccaggtctggagagaggaaaggtt
aatgaagcgggatcattcacagtcgattgctctaaagccggcgaggcagagttgaccatc
gagattatttcagattcaggagcgcaggcggaggttcatgtccagaacaacagcgacggg
acatattcgatcacctacatccctcctttccacggaatgtacactatcacaattaaatat
ggaggacatgcagtgccaaagttccctgcaagggttcaggtagatcccgctcttgacacc
agtgggatcaaggtctacggaccaggagtggagcccagaggggtgctccgagaagttact
acacacttcattgttgacactcgggttcacaacaaaatgggtggaaaccacatcaaagtt
cgtattgttaacccttcaggtgccaacactgatgcgtatgtcactgacaaagcagacggc
acttacagagtggagtatactgcctatgaggacggtgtgcacctgatagaggtactatat
gatgacgtacctgtcccaaagagcccatttagggtggcggtggccgaaggttgtgatccc
agtcgtgttcgtgcctatggtcccggtctggaagaaggtctggtcaacaagccaaaccgc
ttcactgtggagaccagaggagctggcacgggtggtcttgggttggccattgagggtcca
tcagaagctaagatgtcttgtaaagataacaaagatggcagctgcagtgtggaatatatt
cctttcactccaggagaatatgacgtcaacattactttcggaggtctgcctatcccaggt
agtccatttagggtgcctgtaagggagctggtggaccccagtaaggtcaaatgcactggt
cctggtctgggcagtggagtaagagcccatgtcccacaaaccttcactgtggactgcagc
aaggctggactcgccccactggaggttctgctgtatggacctacagggatgacagagccg
gtgaatatcacagacaacggcgatggcacacatacagtggtctacactcctgctaaagat
ggaccttacactgtgtgtgtcaagtatgcagaccaagaagtgccacgaagtccattcaaa
atcaaggtgttacctgctcatgatgccagtaaagttcgtgccagcggtcccggtctgaat
gcttcaggtgttcccgcaagtctaccagtggagttcactattgatgcgcgtgatgcagga
gaaggtcttctcactgtacagatattggacccagaaggaaagccaaagaaagccaacatt
agggataacagagatggaacatacactgtgtcttatgttcctgatatgacggggcggtat
acaattacaatcaaatatggcggagatgaaatcccatactctccctaccgcatccatgcg
ctgcccagtggagatgccagcaaatgccttgtgacagtgtctattgggggacatggactg
ggctctggactcggacctaccattcaaattggcgaggagactgttatcactgtggacgca
aaggctgctgggaaggggaaggtcacttgcaaagtgtcaactccagatggagcggagctg
gatgtggatgtggtggagaatgcagatgggacatttgatatctactatactgctccagaa
cctgggaaatacgttataaccatccgcttcggaggagagcacattcccaacagtcccttc
catgtggtggcttctgataccatccctataatcgaggaaccgtgtgataaactacagtta
cagcagccctacgccccctaccagggctactcccctcactgggccacggaagaaccagtt
actgctgtggacatcatagagccagtgcttcgcccgttcaatttggtcattccatttact
gtgcaaaagggggagattacaggtgaggtacatatgccctctggtaaaaccgccagtcct
cacatcactgataacaaggatgggacagtgactgtcaaatacgcccctaccgaaaagggc
ctgcatgagatggacatcaaatatgatggaaatcacataccaggaagcccactgcagttc
tatgtggatgccattaacagcgggcatgtgaatgcatacggccctggtctgagtcacggg
atggtcaacaaatccgctacattcacaatcgtcactaaggatgctggagaaggtggtctg
tcattggcagtggaaggaccctccaaggcagagatcagctgtaaggataataaagatggc
acctgcactgtatcctacctgccaacggccccgggagactacaacataatcgtcaaattt
gatgacaagcacatcgctggaagcccctttacagccaagatcacaggtgatgactccatg
aggacttctcagctgaacgttggcacagccacagacgtgtctctgaagatcacggagaca
gacctgagctctctgtctgcgaccatcagagccccatctggcaacgaggaaccctgcctg
ctgaagagactgccaaaccgacacatcggaatatcatttactcctaaagaggtgggcgag
catgtggtgagcgtgaagaagaacgggaaacacgtgaccaacagcccgttcaagatcatg
gtaggccagtcggagatcggagatgccagtaaggtgaaggtgtctggaaaaggtctgatt
gaaggacacacttttgaagtggctgagttcattgtggacaccagaagtgcaggatatggc
ggtcttggtttgtccatcgaggggccaagcaaggttgacatcaattgttcggatgtagac
gatggaacatgcaaagtgacctactgccccactgaacctggaacttacatcatcaacatt
aaattcgcagaccaacatgtgccaggtagtccattcacagtgaaggttctgggggaggga
agaatgaaggaaagtattaccaggaaaaggcaagcgccgtctatcgccacagtgggcagc
acttgtgacctcaatctcaagattccagggaactggtttcagatggtatcggcccaagag
agactcacgcgtaccttcacccgcagcagccacacctacacacgcacagagcgcaccgag
atcagcaagacccgggcgggcgagaccaaacgggaggtgcgggtggaagaaagcacccag
gtggggggcgaccccttcagggatgttttcggtggattcatgggaagggaaagcctggga
cccttcaacagtccccagggccgacaatcagagggtgaatcgggtacacaggagatgact
gcacaggtgacgagtcccagtgggaatacggaggacgctgagatcattgaaggagaggac
agcacctatagtgtgcgtttcgtgccacacgagatgggccctcacacggtcaatgtaaaa
tacaggggtcaacatgttcctggaagccccttccagttcaccgtggggcccctgggagag
ggaggagcccataaggttcgggctggcggtaccggattggacaggggtgtggctggagtt
ccagctgagtttagtatctggacccgtgaggccggtgctggtggtttgtccattgctgtt
gagggtcccagcaaagcagagatttcctttgaggacaggaaggatggctcctgtggtgtg
gcctacattgtacaggaacctggcgactatgaggtgtcaatcaaatttaatgacgaacat
atcccagacagccctttcatcgttcctattgcctcactgtcagatgacgctcgtcttctt
accgtcaccagcctgcaggaaatgggtctgaaggtgaatcaggaagcctcgtttgctgta
cagctaaacggagcgagaggtgcgattgatgctaaggtgcacacgccatctggagctgtg
gaggagtgttatattactgagctggacaatgataaacacgccatacggtttattccccgg
gagaacggtgtccattccatcgatgtccgttttaatgggagccacatcccaggcagcccc
ttcaagatccgagtcggggaacctggtcaggcaggagatccaggaatggtgactgctttt
gggcctggactggagggaggaacgacaggcgtaccatcagatttcattgtgaacacatgt
aatgctgggtcaggagctctgtcggtcactattgacggcccgtccaaggtgaagatggat
tgtcaggagtgtccggaaggatacaaggtcacctacacacctatggctcccggcagctac
ctcatctccatcaaatatggtggaccgcagcatatcgtgggcagccccttcaaagccaaa
gtctctggtgcacgtctgtctggcggccactctctacacgaaacctcatcagttctggtg
gaaacggtgacaaagtcctcatccgtggctggatctttctctactctgccaaagttttca
tctgacgccagtaaggtggtctccaggggggcaggcctctccaaagccttcatcggccag
aagaacacctttactgtggactgcagtaaagcagggacaaacatgctaatggtgggagtt
cacgggccaaagacgccctgtgaggaggtgtacgtcaaacacatgggcaaccgaatgtac
aacgtcacatacacggtgaaagagaaaggagactacattctcatagtcaaatggggtgaa
gaaatggtgcccggaagccctttccacgtcacagtgccttaa

DBGET integrated database retrieval system