KEGG   Danio rerio (zebrafish): 570288Help
Entry
570288            CDS       T01004                                 

Gene name
flncb, im:7139256, wu:fc02d03
Definition
(RefSeq) filamin C, gamma b (actin binding protein 280)
  KO
K04437  
filamin
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    570288 (flncb)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    570288 (flncb)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    570288 (flncb)
Cytoskeleton proteins [BR:dre04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     570288 (flncb)
  Intermediate filaments
   Intermediate filament-binding proteins
    570288 (flncb)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   570288 (flncb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
4
AA seq 2773 aa AA seqDB search
MMSNNTYYDQQLPPQYYQGTDNGEDGDEEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLK
CLNRKILDLQKDLTDGLKLIGLLEVLSQKKMYRKYHARPNFRQMKLENVSVALEFLEREH
IKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKLTPKQRLLGWIQN
KVPQLHINNFHRDWRDGKALGALVDNCAPGLCPDWETWDPSQPVENAREAMQQADDWLGV
PQVIAPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKTLHPKRAKAYGPGIEPRGNV
VLKPAEFVVETVEAGLGEVLVYIEDPEGHTEEARVIPNNDRNRSYSVVYVPKVEGLHKVK
VLFAGQDIDRSPFLVNVSKALGDPNKVQARGPGLEPVGNVANKPTYFDIYTAGAGAGDVG
VIIVDSQGRRDTVEIILENKGDSVFRCTYGPILEGPHTIYVTFAGQQIPRSPFTVHISEA
PPHGRQIGSPVHIIPQSLRTPPSEKAKKVPPPTPPKPRRPTSNPNACRAIGRGLQPKGVR
VKEVADFKVYTKGAGSGELRVHVKGPTGGDEPVKVEDLGDGVYECDYYPIFCGKYIITVT
WGGHAIPRSPFEVIISEDAGPQKVRAWGPGLETGMVGKSADFVVEAIGTEVGTLGFSIEG
PSQAKIECDDKGDGSCDVLYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAASDVFPEKV
KCYGPGLEPTGCIVNKPAEFTIDARGAGRGQLQIYAQDSEGFPINIQITDNGDSTYFCVY
IPIKPIKHTIIITWGEVNVPNSPFRVTIGEGSHPENVKVHGPGVEKTGLKANEPTYFTVD
CSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGRYTIMVLFADQ
EIPISPFRIKVDPSHDANKVKAEGPGLNKTGVEVGKPTHFTIYTKGAGKATPEVHFTASG
RGDAVSDFEIIDNHDYSFTVRYTALQQGNMTISVCHGGDPIPKSPFTISVAPPLDLNKVK
VHGLNNKVDVGKDEEFTVNTRGAGGQGKVDVKITSPSRRPIPCKVESGASNEVHTVKYIP
PEEGPYKVDISYDGNPVPGSPFTVEGVMPPDPSKVRAYGPGLKGGIVGKPAPFAIDTKGA
GTGGLGLTVEGPCEAKIECQDNGDGSCSVSYLPTEPGEYSINILFADAHIPGSPFKAMVQ
SVFDPSKVTASGPGLERGKVNEAGSFTVDCSKAGEAELTIEIISDSGAQAEVHVQNNSDG
TYSITYIPPFHGMYTITIKYGGHAVPKFPARVQVDPALDTSGIKVYGPGVEPRGVLREVT
THFIVDTRVHNKMGGNHIKVRIVNPSGANTDAYVTDKADGTYRVEYTAYEDGVHLIEVLY
DDVPVPKSPFRVAVAEGCDPSRVRAYGPGLEEGLVNKPNRFTVETRGAGTGGLGLAIEGP
SEAKMSCKDNKDGSCSVEYIPFTPGEYDVNITFGGLPIPGSPFRVPVRELVDPSKVKCTG
PGLGSGVRAHVPQTFTVDCSKAGLAPLEVLLYGPTGMTEPVNITDNGDGTHTVVYTPAKD
GPYTVCVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGVPASLPVEFTIDARDAG
EGLLTVQILDPEGKPKKANIRDNRDGTYTVSYVPDMTGRYTITIKYGGDEIPYSPYRIHA
LPSGDASKCLVTVSIGGHGLGSGLGPTIQIGEETVITVDAKAAGKGKVTCKVSTPDGAEL
DVDVVENADGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVASDTIPIIEEPCDKLQL
QQPYAPYQGYSPHWATEEPVTAVDIIEPVLRPFNLVIPFTVQKGEITGEVHMPSGKTASP
HITDNKDGTVTVKYAPTEKGLHEMDIKYDGNHIPGSPLQFYVDAINSGHVNAYGPGLSHG
MVNKSATFTIVTKDAGEGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTAPGDYNIIVKF
DDKHIAGSPFTAKITGDDSMRTSQLNVGTATDVSLKITETDLSSLSATIRAPSGNEEPCL
LKRLPNRHIGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGQSEIGDASKVKVSGKGLI
EGHTFEVAEFIVDTRSAGYGGLGLSIEGPSKVDINCSDVDDGTCKVTYCPTEPGTYIINI
KFADQHVPGSPFTVKVLGEGRMKESITRKRQAPSIATVGSTCDLNLKIPGNWFQMVSAQE
RLTRTFTRSSHTYTRTERTEISKTRAGETKREVRVEESTQVGGDPFRDVFGGFMGRESLG
PFNSPQGRQSEGESGTQEMTAQVTSPSGNTEDAEIIEGEDSTYSVRFVPHEMGPHTVNVK
YRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLDRGVAGVPAEFSIWTREAGAGGLSIAV
EGPSKAEISFEDRKDGSCGVAYIVQEPGDYEVSIKFNDEHIPDSPFIVPIASLSDDARLL
TVTSLQEMGLKVNQEASFAVQLNGARGAIDAKVHTPSGAVEECYITELDNDKHAIRFIPR
ENGVHSIDVRFNGSHIPGSPFKIRVGEPGQAGDPGMVTAFGPGLEGGTTGVPSDFIVNTC
NAGSGALSVTIDGPSKVKMDCQECPEGYKVTYTPMAPGSYLISIKYGGPQHIVGSPFKAK
VSGARLSGGHSLHETSSVLVETVTKSSSVAGSFSTLPKFSSDASKVVSRGAGLSKAFIGQ
KNTFTVDCSKAGTNMLMVGVHGPKTPCEEVYVKHMGNRMYNVTYTVKEKGDYILIVKWGE
EMVPGSPFHVTVP
NT seq 8322 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcaataatacatactacgaccagcagctgccgccgcagtattaccagggcacc
gacaacggcgaggacggagacgaggagatgccggccacggagaaggacctggccgaggat
gcgccctggaagaagatccagcagaacaccttcaccaggtggtgcaacgaacacctgaaa
tgcctcaacagaaagatcctggatctgcagaaggacctgaccgacgggctcaagctcatc
gggctcctggaagttctcagccagaagaaaatgtacagaaagtaccacgccagacccaat
ttcaggcagatgaagctggagaatgtgtcagtggcgctggagtttctggaaagggaacac
atcaaactggtttcaatagatagtaaagctatagtggacggcaacctaaaactgatcctg
gggctgatatggacccttatcctgcactactccatttccatgcccatgtgggaggacgag
gacgatgaagacgccagaaagctgacgcccaaacagcgcctcctgggctggatccagaat
aaagtcccccagttgcacatcaacaacttccacagggactggagagatggcaaagccctc
ggtgcattggtggataactgcgcaccaggcctgtgtccggactgggaaacatgggatccg
agtcagcctgtggaaaatgcaagagaagccatgcagcaagccgacgattggcttggtgtg
cctcaggtcattgctccagaggagattgtggatcctaatgtggacgagcattcggtgatg
acctacctgtcgcagttccccaaagccaaactcaagcctggtgcaccactgcgacccaaa
actctgcaccccaagagagccaaggcctacggaccaggtattgagcccagagggaacgtt
gtgttgaagccagccgagtttgtggtggagaccgtggaggccgggcttggagaggtgttg
gtctacattgaagatccagagggacacacagaagaggctagagtaattcccaacaatgac
aggaacaggagttactctgtggtgtatgttccgaaagtggagggtttgcataaggtgaaa
gttttgtttgctggacaggacattgacagaagccctttcttagtaaatgtgtctaaagca
ctgggagacccaaacaaggtgcaggccagagggccaggtttggaaccggtgggcaacgtg
gccaataaacccacctattttgacatctacactgcaggtgcaggagcaggtgatgttggt
gtgatcattgtggactctcagggccgtagagacacagtggagatcattctggaaaacaag
ggtgacagtgttttccgttgcacctatggccccattctggagggccctcacactatatat
gtgacattcgccggccagcaaatacccagaagtcctttcactgtgcacatctcagaggct
cctccacatggccggcagatcggctccccggttcacataatcccccagtctttacgcacg
ccgccctcagaaaaggccaagaaagtgcctcccccaacaccacccaaacccaggcgacca
acaagtaaccccaatgcttgtcgggcaattggtcgtggcctgcagcccaagggtgtacgt
gtgaaggaggtggctgattttaaggtttacacgaagggagcaggcagtggagaactacgt
gttcatgtcaaggggccaacaggtggcgatgagcctgtgaaggtggaagatttgggagac
ggtgtgtatgaatgtgattactatcctattttctgtggaaaatacatcatcaccgttact
tggggtggccatgccattccccgcagtccatttgaggtgatcataagtgaagatgcagga
cctcagaaggtgagggcatggggtccaggcttggagacgggcatggtgggcaaatcagct
gattttgtggttgaagccattggcacagaggttggaactctgggcttttccatcgaaggg
ccctcgcaggctaagatagagtgtgatgacaagggtgatggctcttgtgatgttttgtac
tggcccactgagccaggggactatgcagtccatgtcatctgcgatgatgaagatattaaa
gacagcccctttatggcccacatcctccctgcagccagtgacgttttccctgagaaggtt
aagtgttacggccccgggctggagccaaccgggtgcatcgtaaataaacctgcagagttt
acaattgatgcccgtggagctggaagaggacagctacaaatttatgctcaggactcagaa
gggtttcccatcaacatccagatcacagataacggcgacagcacatatttctgcgtctat
atacccatcaagcccatcaaacacactatcatcatcacatggggagaggtcaacgttccc
aacagtcctttcagggtgaccattggagaaggcagtcaccctgagaatgtgaaggttcat
ggaccaggagtagaaaagactggcttaaaggccaacgaacccacatacttcacagtggac
tgcagtgaggctggacagggagatgtaagcattgggattaagtgcgctcctggtgtggtg
ggacctgcggaagcagatattgattttgacatcattaaaaatgacaatgacacattcaca
gtgaagtatacaccccctggtgctggacgctacacaatcatggtgctatttgcagatcaa
gaaattcccatcagccccttccgtatcaaagttgatccatctcatgatgctaataaggtc
aaagcagagggtcctggcctcaacaagacaggtgtggaagtgggcaagccaacccacttt
acaatctacactaaaggagcaggcaaggccacacctgaggttcacttcactgcatctggt
agaggagatgctgtcagtgactttgagatcatcgataaccatgactattctttcactgtg
cgctacactgcattacagcaggggaacatgactatatctgtgtgccatggtggtgacccc
attcccaaaagcccatttaccatctccgttgctcctcctttagacctcaacaaggtcaaa
gtccatggactcaacaataaagtggatgtcgggaaggatgaggagtttactgttaataca
cgtggtgcgggaggtcaaggaaaggtggacgtcaagattacctcaccctctcgtcggcca
atcccgtgcaaggtggaatctggcgcgtccaatgaggtgcacactgttaagtacattcct
ccagaggaggggccctacaaagtggacatcagctatgatggaaaccctgtgccaggaagc
cctttcacagtggagggggtgatgcctccagatccctcaaaggtacgggcttatgggcct
ggtttgaagggaggcattgtgggtaagccggctccatttgccatcgacaccaaaggtgct
ggcacaggtggtctcggtctgactgtggaaggcccatgcgaagccaaaatcgagtgccag
gacaatggagatggatcttgctctgtgtcttatctgccaaccgaacctggagagtattcc
atcaacatcctgtttgctgatgctcatatcccaggttccccatttaaagctatggtgcag
tccgtctttgacccaagcaaggtcacagctagtggaccaggtctggagagaggaaaggtt
aatgaagcgggatcattcacagtcgattgctctaaagccggcgaggcagagttgaccatc
gagattatttcagattcaggagcgcaggcggaggttcatgtccagaacaacagcgacggg
acatattcgatcacctacatccctcctttccacggaatgtacactatcacaattaaatat
ggaggacatgcagtgccaaagttccctgcaagggttcaggtagatcccgctcttgacacc
agtgggatcaaggtctacggaccaggagtggagcccagaggggtgctccgagaagttact
acacacttcattgttgacactcgggttcacaacaaaatgggtggaaaccacatcaaagtt
cgtattgttaacccttcaggtgccaacactgatgcgtatgtcactgacaaagcagacggc
acttacagagtggagtatactgcctatgaggacggtgtgcacctgatagaggtactatat
gatgacgtacctgtcccaaagagcccatttagggtggcggtggccgaaggttgtgatccc
agtcgtgttcgtgcctatggtcccggtctggaagaaggtctggtcaacaagccaaaccgc
ttcactgtggagaccagaggagctggcacgggtggtcttgggttggccattgagggtcca
tcagaagctaagatgtcttgtaaagataacaaagatggcagctgcagtgtggaatatatt
cctttcactccaggagaatatgacgtcaacattactttcggaggtctgcctatcccaggt
agtccatttagggtgcctgtaagggagctggtggaccccagtaaggtcaaatgcactggt
cctggtctgggcagtggagtaagagcccatgtcccacaaaccttcactgtggactgcagc
aaggctggactcgccccactggaggttctgctgtatggacctacagggatgacagagccg
gtgaatatcacagacaacggcgatggcacacatacagtggtctacactcctgctaaagat
ggaccttacactgtgtgtgtcaagtatgcagaccaagaagtgccacgaagtccattcaaa
atcaaggtgttacctgctcatgatgccagtaaagttcgtgccagcggtcccggtctgaat
gcttcaggtgttcccgcaagtctaccagtggagttcactattgatgcgcgtgatgcagga
gaaggtcttctcactgtacagatattggacccagaaggaaagccaaagaaagccaacatt
agggataacagagatggaacatacactgtgtcttatgttcctgatatgacggggcggtat
acaattacaatcaaatatggcggagatgaaatcccatactctccctaccgcatccatgcg
ctgcccagtggagatgccagcaaatgccttgtgacagtgtctattgggggacatggactg
ggctctggactcggacctaccattcaaattggcgaggagactgttatcactgtggacgca
aaggctgctgggaaggggaaggtcacttgcaaagtgtcaactccagatggagcggagctg
gatgtggatgtggtggagaatgcagatgggacatttgatatctactatactgctccagaa
cctgggaaatacgttataaccatccgcttcggaggagagcacattcccaacagtcccttc
catgtggtggcttctgataccatccctataatcgaggaaccgtgtgataaactacagtta
cagcagccctacgccccctaccagggctactcccctcactgggccacggaagaaccagtt
actgctgtggacatcatagagccagtgcttcgcccgttcaatttggtcattccatttact
gtgcaaaagggggagattacaggtgaggtacatatgccctctggtaaaaccgccagtcct
cacatcactgataacaaggatgggacagtgactgtcaaatacgcccctaccgaaaagggc
ctgcatgagatggacatcaaatatgatggaaatcacataccaggaagcccactgcagttc
tatgtggatgccattaacagcgggcatgtgaatgcatacggccctggtctgagtcacggg
atggtcaacaaatccgctacattcacaatcgtcactaaggatgctggagaaggtggtctg
tcattggcagtggaaggaccctccaaggcagagatcagctgtaaggataataaagatggc
acctgcactgtatcctacctgccaacggccccgggagactacaacataatcgtcaaattt
gatgacaagcacatcgctggaagcccctttacagccaagatcacaggtgatgactccatg
aggacttctcagctgaacgttggcacagccacagacgtgtctctgaagatcacggagaca
gacctgagctctctgtctgcgaccatcagagccccatctggcaacgaggaaccctgcctg
ctgaagagactgccaaaccgacacatcggaatatcatttactcctaaagaggtgggcgag
catgtggtgagcgtgaagaagaacgggaaacacgtgaccaacagcccgttcaagatcatg
gtaggccagtcggagatcggagatgccagtaaggtgaaggtgtctggaaaaggtctgatt
gaaggacacacttttgaagtggctgagttcattgtggacaccagaagtgcaggatatggc
ggtcttggtttgtccatcgaggggccaagcaaggttgacatcaattgttcggatgtagac
gatggaacatgcaaagtgacctactgccccactgaacctggaacttacatcatcaacatt
aaattcgcagaccaacatgtgccaggtagtccattcacagtgaaggttctgggggaggga
agaatgaaggaaagtattaccaggaaaaggcaagcgccgtctatcgccacagtgggcagc
acttgtgacctcaatctcaagattccagggaactggtttcagatggtatcggcccaagag
agactcacgcgtaccttcacccgcagcagccacacctacacacgcacagagcgcaccgag
atcagcaagacccgggcgggcgagaccaaacgggaggtgcgggtggaagaaagcacccag
gtggggggcgaccccttcagggatgttttcggtggattcatgggaagggaaagcctggga
cccttcaacagtccccagggccgacaatcagagggtgaatcgggtacacaggagatgact
gcacaggtgacgagtcccagtgggaatacggaggacgctgagatcattgaaggagaggac
agcacctatagtgtgcgtttcgtgccacacgagatgggccctcacacggtcaatgtaaaa
tacaggggtcaacatgttcctggaagccccttccagttcaccgtggggcccctgggagag
ggaggagcccataaggttcgggctggcggtaccggattggacaggggtgtggctggagtt
ccagctgagtttagtatctggacccgtgaggccggtgctggtggtttgtccattgctgtt
gagggtcccagcaaagcagagatttcctttgaggacaggaaggatggctcctgtggtgtg
gcctacattgtacaggaacctggcgactatgaggtgtcaatcaaatttaatgacgaacat
atcccagacagccctttcatcgttcctattgcctcactgtcagatgacgctcgtcttctt
accgtcaccagcctgcaggaaatgggtctgaaggtgaatcaggaagcctcgtttgctgta
cagctaaacggagcgagaggtgcgattgatgctaaggtgcacacgccatctggagctgtg
gaggagtgttatattactgagctggacaatgataaacacgccatacggtttattccccgg
gagaacggtgtccattccatcgatgtccgttttaatgggagccacatcccaggcagcccc
ttcaagatccgagtcggggaacctggtcaggcaggagatccaggaatggtgactgctttt
gggcctggactggagggaggaacgacaggcgtaccatcagatttcattgtgaacacatgt
aatgctgggtcaggagctctgtcggtcactattgacggcccgtccaaggtgaagatggat
tgtcaggagtgtccggaaggatacaaggtcacctacacacctatggctcccggcagctac
ctcatctccatcaaatatggtggaccgcagcatatcgtgggcagccccttcaaagccaaa
gtctctggtgcacgtctgtctggcggccactctctacacgaaacctcatcagttctggtg
gaaacggtgacaaagtcctcatccgtggctggatctttctctactctgccaaagttttca
tctgacgccagtaaggtggtctccaggggggcaggcctctccaaagccttcatcggccag
aagaacacctttactgtggactgcagtaaagcagggacaaacatgctaatggtgggagtt
cacgggccaaagacgccctgtgaggaggtgtacgtcaaacacatgggcaaccgaatgtac
aacgtcacatacacggtgaaagagaaaggagactacattctcatagtcaaatggggtgaa
gaaatggtgcccggaagccctttccacgtcacagtgccttaa

DBGET integrated database retrieval system