KEGG   Danio rerio (zebrafish): 570368Help
Entry
570368            CDS       T01004                                 

Gene name
arg1, si:ch211-146f4.3
Definition
arginase, liver (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dre01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dre00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
12
AA seq 341 aa AA seqDB search
MMKMKSLSGSRAALHIFRRHLHHQRYSVGIIGAPFSKGQQKDGVQEGADLIRAAGLVQKL
KGQGCVVKDYGNVTFENLPNDESIGRLKTPRAVGRANELLSGAVQKIKSDGNTCVMLGGD
HSLAIGSISGHAAYRHELSVLWVDAHADINTPLTTPTGNIHGQPMSYLIHELHSKMPKLP
NFSWLKPCIAAQDVVYIGLRDVDPEEHYILKYLGIKTFSMTEVDRLGIAKVMEQTCDHMF
SKVKKPIHLSFDIDALDPSVSPATGTPVAGGLTYREGIYITEHICQTGLLSAVDMVEVNP
KLGRTADEIKSTVNAAVDLLLGCFGRIREGSHDPDYKMPNP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagatgaagagccttagcggatcacgagcagctcttcacatattcaggagacac
ctccatcatcagcggtactctgtgggaataataggcgctccgttctccaaaggacagcag
aaggatggtgtgcaggaaggagcagacctcattcgagccgctggactggtgcagaaactt
aaagggcaaggttgtgtggtgaaggattatgggaatgtgacatttgaaaaccttcccaac
gacgagtccatcgggagactcaagaccccgagagcggtgggacgagcaaatgagctgctt
tcaggggctgtgcaaaagatcaagagtgatggaaacacatgcgtgatgctgggaggagat
cacagcctggcgatcggctcaatctctggtcatgctgcatacagacatgagctgagtgtt
ttatgggtggacgcacacgcagacatcaacacacctttaaccacaccgactggaaatatt
cacggccagccgatgtcttacctcatccacgaactgcactccaagatgcccaaacttcca
aatttctcatggctaaagccttgcatagcagctcaggatgttgtgtatattggactccga
gacgtggacccggaagaacattatatccttaaatacctgggcatcaaaaccttctccatg
actgaagttgatcgacttggaatagcaaaagtcatggagcagacgtgtgatcacatgttt
tcaaaagtgaagaagccgatccatctgagtttcgacattgatgcgctggacccgtcagtg
tcaccggcgactggcacacctgtagcaggaggactgacctatagagagggcatttacatc
actgagcacatctgccaaacagggcttctctctgctgtagacatggtggaagtgaacccc
aaactgggcagaacagcggacgagatcaaatcaacagtaaacgctgctgtggatctgctg
ctgggctgctttggacggattcgcgaaggctctcatgacccagattacaaaatgccaaat
ccataa

DBGET integrated database retrieval system