KEGG   Danio rerio (zebrafish): 570457Help
Entry
570457            CDS       T01004                                 

Gene name
aox1, si:ch211-246m6.10
Definition
aldehyde oxidase 1 (EC:1.2.3.1)
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    570457 (aox1)
   00350 Tyrosine metabolism
    570457 (aox1)
   00380 Tryptophan metabolism
    570457 (aox1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    570457 (aox1)
   00760 Nicotinate and nicotinamide metabolism
    570457 (aox1)
   00830 Retinol metabolism
    570457 (aox1)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    570457 (aox1)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     570457 (aox1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
22
AA seq 1338 aa AA seqDB search
MAEQTRNDGLIFYVNGKKIVEKNPDPETMLLPYLRKKLRLTGTKYSCGGGGCGACTIMVS
RYDPQTKSISHLSVNGCLFPICHLHGAAVTTVEGIGNTKTKLHPVQERIAKAHGSQCGFC
TPGMVMSMYTLLRNNPHPTLDDITECLAGNLCRCTGYRPIIDGYRTFCESENCCLLNGST
CNVLNGNGSAENGHAELFSKDDLLPLDPSQDLIFPPELMRMAEDKDQSIQRFCGERMTWI
SPGSLDELLQLKADYPQAPLVMGNTTIGLDMKFKGIFHPIIISPTRVPELFKVNHRSEGV
CVGAGCSMSDLKSVLEKTINDFPPENTHTFRALLQQINLVGGQQIRNVATLGGNIASAYP
NSDLTPVLAAGRCTLVALSKDGRRRLPIDKDFFLGFAKTILKPEEILLSVFIPATRQNEI
VHAFRHVPRKENALATLNAGMRVWLNDNSNVVKEISIYYGGVGATILSADHACQKIVGRP
WEEATLNDAYSALFDDVKLDPAAPGGKVDFRRSLTLSLLFKFHLLILQYLKEKDVIQMEV
PQEMQSAIQPLPKRILPGYQEFQNVLEDQSAQDLVGRPMMHRSALSQATGEAVYCDDLPY
TDGELVLAIVTSSKAHAKITHIDFSEALKLPGVVDVITAKDIPGKKFRTFTGYDEELLAE
DEVSCVGQMICAVVADSKAHAKRGAAAVKVSYEDLQDCIFTLEEAIEKESFFLPRRQIER
GDVEKGLRDAEQVYEGEIRIGGQEHFYMETQSFLVVPVGEEKEMKVYLSTQHPTYTQEAV
AETLGIPSNRVTCHVKRLGGAFGGKVTKTAILASITAAAAWKTGLPVRCVLERGEDMLIT
GGRHPVWGKYKVGFMKNGRITAADFQYYANSGNKVDESVLVAEKILLHLDNAYNIPNLRG
RSAACRTNLPSNTAFRGFGVPQCMLVIESMIDDVALQLGRLPEEIREMNMYKQVSLTHYK
MEFDPENLVRCWKECMEKSDFSHRRKAIDLFNQQNQFKKRGISIIPIKYGIGFAEGFLNQ
AAALVHIYKDGSVLVSHGGAEMGQGLHTKIQQVASRELNIPASLIHISETSTQCVPNTCP
SAASFGTDANGMAVQDACQILYNRLEPVRKKDPKGTWQNWIMKAFLEKISLSATGYYRGH
DLDMDWEKQEGRPYAYFTYAVCCSEVELDCLTGEYRTLRTDIVVDIGRSINPSIDIGQIE
GAFTQGLGLYTMEELKYSPSGVLYTRGPGQYKIPAVCDVPLNFNVYLLAGSSNPHAIYSS
KGIGEPTLFLGSSVFFAIKDAVTAARKDAGLTGPFQLNSPATPERACLACATRFTNMVVA
QNEPVSTSGPARPWALDI
NT seq 4017 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaaaccaggaacgatggcttgatattctatgtcaacggcaaaaagatagtg
gagaagaacccagatcctgagactatgcttctgccctatttgaggaaaaaattgcgtttg
actggcactaaatacagctgtggtggaggaggatgtggagcttgtaccatcatggtgtcc
agatatgaccctcagactaagagcatcagtcatttgtcagtgaacgggtgtctgtttccc
atctgccatcttcacggagccgcagtgacaactgttgaaggcatcggaaacaccaaaacc
aaattacacccggtccaggagcgcatagcaaaggctcatgggtctcaatgtggcttctgt
actcctgggatggtgatgtccatgtatacattgctaagaaacaacccacatcccaccttg
gatgacataacagagtgtcttgcaggtaatttatgcagatgtacaggataccggcccatc
attgatggctacaggaccttctgtgagagtgaaaactgttgcctgttaaatggcagcacg
tgtaatgtgctcaatggaaatggatctgcggagaatggtcatgcagagctgttcagtaaa
gatgacctgcttcccctcgacccgtcccaggacctgatctttcctcctgagctcatgaga
atggcggaggacaaggatcagagcattcagaggttctgtggggagagaatgacctggatc
agtcctggatctctagatgagctgctccagctgaaggctgattacccacaagcccctttg
gtcatggggaacaccactataggtttggacatgaaattcaagggtatcttccatcccata
ataatatctccaacacgagtcccagaattgttcaaggttaaccacagatcagagggtgtg
tgtgtcggagctggatgtagtatgtcagatctgaagagcgtgttggagaaaactataaat
gattttccaccagagaacacacacacgtttcgggctcttctgcagcagataaacctcgtt
ggaggacaacagatccgcaacgtggctacactgggtggcaatattgcaagtgcatatcca
aactcagacctgacccctgtgttagctgctggcagatgcactcttgtagctctttctaaa
gatggacgaagaaggctgcctattgataaagactttttccttggatttgcaaagacgatt
ctaaagccagaagaaatactgttgtctgttttcattccagctacaagacaaaacgagatt
gtccatgccttccgacacgtcccgcgcaaggaaaacgcattagccacactgaatgctggg
atgcgggtttggctcaatgacaactcaaatgtggtgaaggagatcagtatttactatgga
ggagttggagccacaattctcagcgcagaccatgcatgccagaagattgtaggaaggcct
tgggaagaggcgacattaaacgatgcgtacagcgcactgtttgatgacgtcaaacttgac
cctgcggctccaggcgggaaagtggatttcagaagatccctgactttgagcttgcttttt
aaattccatctactcatcctccagtatctgaaggaaaaagatgtgattcagatggaagta
ccacaagagatgcaaagtgcgattcaacctcttccaaaacgcattctacctggttatcaa
gaatttcagaatgtcttggaggaccagtcggctcaagatctggtgggccgtccaatgatg
caccggtcagctctgagtcaggctactggagaggcagtctactgtgatgatctgccatac
accgatggtgaacttgtccttgccattgtgaccagctccaaagcacatgccaaaatcact
catattgacttcagtgaagctctgaagctgcctggtgttgtggacgtaatcactgctaaa
gacataccgggcaaaaagttcagaaccttcaccggctatgatgaggaactgctggctgaa
gatgaggtgtcctgtgttggtcagatgatctgcgctgtggttgcagattcaaaagcgcat
gctaaacgtggagcggcagcggtaaaagttagctatgaagatctacaggattgcatcttc
actttggaggaggccatcgaaaaagagtctttcttcctgcctagaagacagatcgagcga
ggagatgtggaaaagggattgagagatgccgagcaagtgtatgaaggggagattcggatt
ggaggacaggagcatttctacatggaaactcagagttttctggtcgttccagttggggaa
gagaaggagatgaaggtttatttgtcaactcagcatcctacatatacgcaggaggcagtt
gcagaaacgttgggaattccatccaatcgtgttacttgtcacgttaagcgattgggcgga
gccttcgggggaaaggtcaccaaaactgccattttggcctccatcactgcagctgcggca
tggaaaactggacttccagtgcgatgtgttttggaaagaggagaagacatgctgataacc
ggaggacgtcacccagtgtggggaaaatacaaggtgggattcatgaagaatggaaggata
acagcagctgatttccagtactacgccaattctggaaacaaagtggatgagtccgtactg
gtcgcagagaagatcctcctgcacctcgataatgcttacaacattcccaacctgcgcgga
cgatctgcagcctgcaggaccaacctgccctccaacactgcatttagagggttcggtgtg
ccccagtgtatgctggtcatcgagagtatgattgatgatgtggctcttcaactcggacgt
ctacctgaagagatcagggagatgaacatgtacaagcaagtttccctcactcactacaag
atggagtttgacccagaaaaccttgtccgctgctggaaggagtgtatggagaaatctgac
ttcagtcatcgccgtaaagccatcgatctcttcaaccagcagaaccagttcaagaagaga
ggaatctccatcatacccatcaaatacggcattggctttgctgagggcttcctcaaccag
gctgcagctctcgtgcacatttataaggatggatctgtgctggtgagccacggcggggca
gaaatgggtcaaggcctacacactaaaatccaacaggtggccagtcgagagctgaatatt
cctgcatctttgatccacatttctgaaaccagcacacagtgtgtcccgaatacctgcccg
tctgctgcatcctttggtaccgatgccaacgggatggcagtgcaggatgcctgccaaata
ttatacaacagactggagccagtcagaaaaaaggatcctaaggggacatggcagaactgg
attatgaaagcgtttttggagaaaatcagtctgtcggcaacaggatattacagaggtcat
gatctggacatggactgggagaagcaggagggaagaccttatgcttactttacatatgca
gtttgctgcagtgaggtggagctagactgtctgactggagagtacaggaccttgaggacg
gatattgttgttgacattggcagaagtataaatccgtccatcgatattggtcagattgag
ggagcgttcacgcagggattgggtctctacaccatggaggagctgaaatattctccgtct
ggtgttttgtacacacgtggcccaggccagtacaagatcccagccgtatgtgacgtcccg
ctcaactttaacgtctatcttttagccggctcatccaaccctcacgccatctattcctca
aaggggattggtgagccaacgttgttcttgggcagttctgtgttcttcgctattaaagac
gctgtgactgcagcccgaaaagatgcaggtttaaccggtccgttccagctgaacagccct
gccaccccagagcgggcatgtctagcctgcgccacacgcttcacaaacatggttgttgca
caaaatgaacctgtgtcaacttctggaccagctcggccttgggcgctggacatataa

DBGET integrated database retrieval system