KEGG   Danio rerio (zebrafish): 570542Help
Entry
570542            CDS       T01004                                 

Gene name
stambpl1
Definition
STAM binding protein-like 1
Orthology
K11867  
AMSH-like protease [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     570542 (stambpl1)
Peptidases [BR:dre01002]
 Metallo Peptidases
  Family M67
   570542 (stambpl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
12
AA seq 466 aa AA seqDB search
MDQGFSFSTLKKLAAEPDHTDVTLPAVERVRALSKMGYNIEINEDIAPRRYFRSGVEMER
MAAVYLEEGSLENAFVLYNKFITLFVEKLPSHRDYQQCNIPEKQVIMKKLQEVAFPRKDQ
LKRLLHEKYSKEHSEYLKSQTQAMAVDMCGAQLQKMSMLEEERQRVAQLRKMQIESEQFR
YFEDQLRRQELASRRDDAGPKVPEQTDGSCLSQTPRNHVRLDPNRNKPAAPIPKPAATLA
AVQNQRVEGLRRVLIPRDLTYRFLLLADSNTARGIETCGVLCGKLTHNEFVLTHVIVPKQ
SAGPDYCDMENVEELFSYQDHHNLLTLGWIHTHPTQTAFLSSVDLHTHSSYQLMLPEAIA
IVCAPKHNESFPAHQCWNGRSGRMQIERFSPPLERPSSVHYLQAHCGERLKNDSPGPQVT
EEDGKYQYQQTIENFYLYLSLLEGFFVFIYFTKRYCDRTPQLRCLL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggaccagggcttcagtttcagcacgctgaagaagttagcagctgagccggatcacact
gatgtcactctgcctgctgtggaacgtgtgcgggccctcagcaaaatgggctataacata
gaaataaacgaagacatcgccccgagacgctactttcgctctggtgtggagatggagcgt
atggcagctgtttatctagaggagggcagcctggagaatgcctttgtcctctacaacaag
ttcatcactttatttgttgagaaactccccagccacagggactatcagcagtgcaacatc
cctgagaagcaggtgataatgaagaaattacaggaagtggcttttccacgcaaggaccaa
ttaaagagacttctccacgagaaatacagcaaagaacacagcgaatatctgaagagtcag
actcaagccatggccgttgacatgtgtggtgcacaactgcagaagatgtctatgctggag
gaagagcggcagcgtgtggcacagctcaggaagatgcagatcgagtctgagcagttccgt
tactttgaggaccaactgcgtagacaggagctggccagtcggagggatgatgctggcccc
aaagtgcctgaacaaactgacgggtcctgtttatcccagacccccagaaaccatgtgcgc
cttgaccccaatcgtaacaaaccagcagcccctattcccaaaccggcagccaccttagca
gctgtacagaatcagcgcgtggaaggcctgaggcgggttttaatcccacgagacctgact
tacaggttccttctgctggcagacagtaacacagcgagaggaattgaaacgtgtggagtt
ctctgtggaaaactgacacataatgagtttgtgctgactcacgtgatcgtcccaaagcag
tctgccggtcctgattactgtgacatggagaatgtggaagagctgttcagttaccaggat
catcataacctactgaccctaggctggatccatactcacccaacgcagacggccttcctc
tccagcgtggatctacatacacacagctcttatcagcttatgctacctgaggccatcgct
attgtttgcgcacctaaacacaatgagagttttccggctcaccagtgctggaatgggaga
agtggccggatgcagattgaaaggttttcacccccactcgaaagaccctcctctgttcac
tatttgcaagcacattgtggtgaaagactcaaaaacgatagtcctggacctcaggtgaca
gaggaagatggaaaatatcagtatcaacaaaccattgagaatttctatttatatctttct
ttacttgaaggcttttttgtatttatttattttacaaaaaggtactgtgacagaacccct
cagctgcgctgtttgctgtga

DBGET integrated database retrieval system