KEGG   Danio rerio (zebrafish): 570542Help
Entry
570542            CDS       T01004                                 

Definition
AMSH-like protease-like
Orthology
K11867  
AMSH-like protease [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     570542
Peptidases [BR:dre01002]
 Metallo Peptidases
  Family M67
   570542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
12
AA seq 420 aa AA seqDB search
MDQGFSFSTLKKLAAEPDHTDVTLPAVERVRALSKMGYNIEINEDIAPRRYFRSGVEMER
MAAVYLEEGSLENAFVLYNKFITLFVEKLPSHRDYQQCNIPEKQVIMKKLQEVAFPRKDQ
LKRLLHEKYSKEHSEYLKSQTQAMAVDMCGAQLQKMSMLEEERQRVAQLRKMQIESEQFR
YFEDQLRRQELASRRDDAGPKVPEQTDGSCLSQTPRNHVRLDPNRNKPAAPIPKPAATLA
AVQNQRVEGLRRVLIPRDLTYRFLLLADSNTARGIETCGVLCGKLTHNEFVLTHVIVPKQ
SAGPDYCDMENVEELFSYQDHHNLLTLGWIHTHPTQTAFLSSVDLHTHSSYQLMLPEAIA
IVCAPKHNDTGVFRLTSAGMGEVAGCRLKGFHPHSKDPPLFTICKHIVVKDSKTIVLDLR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggaccagggcttcagtttcagcacgctgaagaagttagcagctgagccggatcacact
gatgtcactctgcctgctgtggaacgtgtgcgggccctcagcaaaatgggctataacata
gaaataaacgaagacatcgccccgagacgctactttcgctctggtgtggagatggagcgt
atggcagctgtttatctagaggagggcagcctggagaatgcctttgtcctctacaacaag
ttcatcactttatttgttgagaaactccccagccacagggactatcagcagtgcaacatc
cctgagaagcaggtgataatgaagaaattacaggaagtggcttttccacgcaaggaccaa
ttaaagagacttctccacgagaaatacagcaaagaacacagcgaatatctgaagagtcag
actcaagccatggccgttgacatgtgtggtgcacaactgcagaagatgtctatgctggag
gaagagcggcagcgtgtggcacagctcaggaagatgcagatcgagtctgagcagttccgt
tactttgaggaccaactgcgtagacaggagctggccagtcggagggatgatgctggcccc
aaagtgcctgaacaaactgacgggtcctgtttatcccagacccccagaaaccatgtgcgc
cttgaccccaatcgtaacaaaccagcagcccctattcccaaaccggcagccaccttagca
gctgtacagaatcagcgcgtggaaggcctgaggcgggttttaatcccacgagacctgact
tacaggttccttctgctggcagacagtaacacagcgagaggaattgaaacgtgtggagtt
ctctgtggaaaactgacacataatgagtttgtgctgactcacgtgatcgtcccaaagcag
tctgccggtcctgattactgtgacatggagaatgtggaagagctgttcagttaccaggat
catcataacctactgaccctaggctggatccatactcacccaacgcagacggccttcctc
tccagcgtggatctacatacacacagctcttatcagcttatgctacctgaggccatcgct
attgtttgcgcacctaaacacaatgacacaggagttttccggctcaccagtgctggaatg
ggagaagtggccggatgcagattgaaaggttttcacccccactcgaaagaccctcctctg
ttcactatttgcaagcacattgtggtgaaagactcaaaaacgatagtcctggacctcagg
tga

DBGET integrated database retrieval system