KEGG   Danio rerio (zebrafish): 570652Help
Entry
570652            CDS       T01004                                 

Gene name
adcy6a, adcy6
Definition
(RefSeq) adenylate cyclase 6a
  KO
K08046  
adenylate cyclase 6 [EC:4.6.1.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Purine metabolism
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    570652 (adcy6a)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    570652 (adcy6a)
  Cellular community - eukaryotes
   04540 Gap junction
    570652 (adcy6a)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    570652 (adcy6a)
   04914 Progesterone-mediated oocyte maturation
    570652 (adcy6a)
   04916 Melanogenesis
    570652 (adcy6a)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    570652 (adcy6a)
   04270 Vascular smooth muscle contraction
    570652 (adcy6a)
Enzymes [BR:dre01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     570652 (adcy6a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
23
AA seq 1203 aa AA seqDB search
MSWINGFLVARVDDRKTAWGERNGKKSKRKVGSSLCNPRYMSCLRDVEAMEPPPQPPHAQ
ATRSGGPGGGPGGGPGGTGNFGMRCGWQEDHYGKMGSGGEGVGLKSVDLGFEDGDVKGRK
RDGLGGDGSSEDTASGTGSVTAADCWQRVVRVFQSKKFQSRKLERLYQRYFFRLNQSSLT
MLMGVLVIVCGVMLTFHCIHGPPDVVYASVLSVAMALFLALMVVCNRNGFHQDYMWMVSY
LVIGVLIIVQVFGVLMVAPRSASEGIWWSVFFIYIIYTLLPVRMRAAVLSGGVLSAIHLL
TTWRINQDDEFLWKQLSANVLIFLCTNIIGICTHYPAEVSQRQAFQETRGYIQARLHLQR
ENQQQERLLLSVLPRHVAMEMKADINAKKEDMMFHKIYIQKHDNVSILFADIEGFTSLAS
QCTAQELVMTLNELFARFDKLASENHCLRIKILGDCYYCVSGLPEPRADHAHCCVEMGVD
MIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGR
IHITKATLQYLNGDYEVEPGFGGERNAYLKENSIETFLVLGCSQKRKDEKAMMAKMQRTR
TNSNEALVPRWVPDRSFSRTKDSKVFRQMGIDETSSKDNRGAQEALNPEDEVDEFLGRAI
DARSIDQLRKDHVKKFLLTFQTSSLEKKYAKKVDDRFGGYVACTLLVFCFISFIQIVVFP
HTLVMLGIYISIFIILANILFICAIYSCVKLFPAAMQTVSKKIVQSRTNSTLVGVFTIIL
VFISAFVNMFSCDTQKLVDCVAKQLNWSSEMVTPCIIHNMSRSVADGLSICPNNTPSCPF
PEYFSYSVLLTLLACSVFLQISSIGKLALMLLIQLTFLLLVEWPEVALFDNADLFVTANA
LVFNETLQWSNFNTTTEQCTFRVTKVSLKVMTPVILTVFVLALYLHAQQVESTARLDFLW
KLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIS
NFSEFYVELEANNEGVECLRLLNEIIADFDEIISEEKYRQLEKIKTIGSTYMAASGLNDS
TYDKEGRSHITALADYAMHLREQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDI
WGNTVNVASRMDSTGVPDRIQVTTDLHQVLHSKGYQLECRGVIKVKGKGEMTTYFLNDGP
PNS
NT seq 3612 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggatcaacggcttcctagtggccagagtggatgaccgaaagaccgcgtggggc
gagcgcaatggcaagaagtccaagcgcaaggttggctcctctctctgcaacccacgctac
atgagctgcctgcgggacgtggaagccatggagcctcctccccagccgccccacgctcag
gccacccggtctggaggaccaggaggaggaccaggagggggaccagggggaacgggcaac
ttcggcatgcgctgcggatggcaggaagaccactatggcaaaatgggaagcgggggggag
ggtgtggggcttaaatctgtggacctgggcttcgaggatggcgatgttaaagggcggaaa
agggacggtttgggtggtgacggctccagcgaggacaccgccagtggtacggggtcagta
acagctgccgactgctggcagcgggtggttcgcgttttccaatccaagaagttccagtcg
cgcaaactggagcgtctctaccagcgctacttcttcaggcttaaccagagttcgctaaca
atgctaatgggcgttttggtgatcgtctgcggggtcatgctcaccttccactgcattcat
ggcccaccagacgtagtttacgcttcagttttgtctgtggccatggccttgtttttggca
cttatggtggtgtgcaatcgaaatggcttccaccaggactacatgtggatggtcagctat
ctggtcattggagtgctaattatagtgcaggtattcggggtgctaatggtggctccccgc
agtgcctcggaggggatctggtggtccgtcttcttcatctacattatctatacgctgctg
ccggtgcggatgagagcggcggtgctcagcggaggagtgctgtcagctatacacctcctc
accacatggaggatcaatcaggacgatgagttcctctggaaacagctaagcgcaaacgtg
ttgatcttcctgtgcaccaacatcattgggatctgcacacattacccagcagaggtgtct
cagagacaggcctttcaggagacacgtggatacatccaggcccgactgcacctgcagaga
gaaaaccagcagcaggagcgcctgttgctgtctgtcttgccgaggcatgttgccatggag
atgaaggctgacatcaacgctaaaaaagaagacatgatgtttcacaagatctacatccag
aagcacgacaatgtcagtattctgtttgcagacatcgagggattcactagtctggcgtct
cagtgcactgctcaggagctggtcatgactctaaacgagctgttcgcccgctttgacaaa
ctagcatcggagaaccactgcttgcggatcaagattctaggggattgttattactgtgtg
tctggtttgccggagcccagagcagatcatgctcactgctgtgtggagatgggggtcgac
atgatcgaagccatttctctggtgcgagaggtgacgggggtgaacgtgaacatgcgggtg
ggtattcacagcggtcgtgttcactgtggtgttcttggattgagaaaatggcaattcgat
gtgtggtccaacgacgtaacactcgccaaccacatggaagctggaggcaaagctgggagg
atccacatcactaaagcgactctacagtacctgaatggagactatgaggtggagccgggt
ttcggaggggagagaaacgcatacctgaaggagaacagcattgagacgttcctcgtgctg
ggctgcagtcagaagaggaaagacgagaaggccatgatggccaagatgcagcgcacgagg
accaactctaatgaagctctggtgccgcggtgggtgcccgacagatccttctccaggacc
aaagactccaaagtcttcagacagatgggcattgatgaaacctccagcaaagacaaccgt
ggtgctcaggaggcgttgaaccccgaggatgaggtcgatgagtttttgggtcgtgccatc
gacgctcgcagtattgaccagctccgcaaagaccatgtcaagaagttcctcctcaccttc
caaacctccagcctggagaagaagtatgctaagaaggttgatgatcgttttggtggttac
gtggcctgtacgctcctggtcttctgtttcatctcttttatccagatcgtcgtattccct
catactctggtcatgctgggaatttacatcagtatcttcatcattcttgccaacatcctc
tttatctgtgccatttactcctgtgtgaagctcttccccgctgccatgcaaactgtgtcc
aagaagattgttcagtctcgcaccaacagcacactggtgggagttttcaccatcatcctc
gtcttcatctctgcctttgtcaatatgttttcctgtgatacgcagaagctggtggactgt
gtggcaaagcagttgaactggtcttcagagatggtgactccttgtatcattcacaatatg
tctcgatctgtagccgatggcctgagtatttgtcccaacaacactccttcctgccctttt
cctgagtatttcagctacagtgtgctgctgacgctgctggcctgctcagtgtttctgcag
atcagtagtatagggaagctggctttaatgctgctcatccagctcaccttcctgctgctt
gtggagtggccagaggtggcgctgttcgacaacgcagacctcttcgtcactgccaatgcc
cttgttttcaacgaaacactgcaatggtccaatttcaatacgactactgaacagtgcact
ttcagggtgactaaagtgtccctaaaggtcatgaccccagtgatcctcactgtatttgta
ctagcactgtacctacatgcccagcaagtggagtcaacagcccgtctagacttcctttgg
aagcttcaggccacagaagagaaggaggagatggaggaacttcaagcctacaaccgccgg
ctactccacaacatcctgcccaaagacgtggctgcgcactttctggcccgagagcgaagg
aatgacgagctatattatcagtcgtgcgagtgtgtggccgtcatgttcgcctccattagc
aatttctctgagttctacgtggagctggaggccaataacgagggagtggagtgtctgagg
ctcctcaatgagatcatcgctgactttgatgagatcatcagtgaagagaagtacaggcag
ctggagaaaataaagaccattggcagcacctacatggccgcatcaggcctcaatgactcc
acatatgacaaggaaggccgttcgcatataacagcgttggctgactacgccatgcacctc
cgcgaacagatgaaatacatcaatgagcattccttcaacaacttccagatgaagatcgga
ctgaacattgggccagtggtcgcaggtgttattggagccaggaagccccagtatgatatt
tggggaaacacagtaaacgtggccagtcggatggacagtacgggagtcccagaccgtatt
caggtgaccacagatctacaccaggtgttgcacagtaaaggttaccagctggagtgtcga
ggggtcataaaggtgaagggtaagggtgaaatgaccacttacttcctgaacgacggacct
cccaacagttag

DBGET integrated database retrieval system