KEGG   Danio rerio (zebrafish): 570652Help
Entry
570652            CDS       T01004                                 

Gene name
adcy6a, adcy6
Definition
adenylate cyclase 6a
Orthology
K08046  
adenylate cyclase 6 [EC:4.6.1.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Purine metabolism
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    570652 (adcy6a)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    570652 (adcy6a)
  Cell communication
   04540 Gap junction
    570652 (adcy6a)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    570652 (adcy6a)
   04914 Progesterone-mediated oocyte maturation
    570652 (adcy6a)
   04916 Melanogenesis
    570652 (adcy6a)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    570652 (adcy6a)
   04270 Vascular smooth muscle contraction
    570652 (adcy6a)
Enzymes [BR:dre01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     570652 (adcy6a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
23
AA seq 1174 aa AA seqDB search
MSWINGFLVARVDDRKTAWGERNGKKSKRKVGSSLCNPRYMSCLRDVEAMEPPPQPPHAQ
ATRSGGPGGGPGGGPGGTGNFGMRCGWQEDHYGKMGSGGEGVGLKSVDLGFEDGDVKGRK
RDGLGGDGSSEDTASGTGSVTAADCWQRVVRVFQSKKFQSRKLERLYQRYFFRLNQSSLT
IFVCGHGLVFGTYGGVQSKWLPPGLHVDGQLSGHWSANYSAGIRGANGGSPQCLGGDLVV
RLLHLHYLYAAAGADESGGAQRGVLSAIHLLTTWRINQDDEFLWKQLSANVLIFLCTNII
GICTHYPAEVSQRQAFQETRGYIQARLHLQRENQQQERLLLSVLPRHVAMEMKADINAKK
EDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLASENHCLR
IKILGDCYYCVSGLPEPRADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHC
GVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLQYLNGDYEVEPGFGGERNAYL
KENSIETFLVLGCSQKRKDEKAMMAKMQRTRTNSNEALVPRWVPDRSFSRTKDSKVFRQM
GIDETSSKDNRGAQEALNPEDEVDEFLGRAIDARSIDQLRKDHVKKFLLTFQTSSLEKKY
AKKVDDRFGGYVACTLLVFCFISFIQIVVFPHTLVMLGIYISIFIILANILFICAIYSCV
KLFPAAMQTVSKKIVQSRTNSTLVGVFTIILVFISAFVNMFSCDTQKLVDCVAKQLNWSS
EMVTPCIIHNMSRSVADGLSICPNNTPSCPFPEYFSYSVLLTLLACSVFLQISSIGKLAL
MLLIQLTFLLLVEWPEVALFDNADLFVTANALVFNETLQWSNFNTTTEQCTFRVTKVSLK
VMTPVILTVFVLALYLHAQQVESTARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKD
VAAHFLARERRNDELYYQSCECVAVMFASISNFSEFYVELEANNEGVECLRLLNEIIADF
DEIISEEKYRQLEKIKTIGSTYMAASGLNDSTYDKEGRSHITALADYAMHLREQMKYINE
HSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDLHQV
LHSKGYQLECRGVIKVKGKGEMTTYFLNDGPPNS
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggatcaacggcttcctagtggccagagtggatgaccgaaagaccgcgtggggc
gagcgcaatggcaagaagtccaagcgcaaggttggctcctctctctgcaacccacgctac
atgagctgcctgcgggacgtggaagccatggagcctcctccccagccgccccacgctcag
gccacccggtctggaggaccaggaggaggaccaggagggggaccagggggaacgggcaac
ttcggcatgcgctgcggatggcaggaagaccactatggcaaaatgggaagcgggggggag
ggtgtggggcttaaatctgtggacctgggcttcgaggatggcgatgttaaagggcggaaa
agggacggtttgggtggtgacggctccagcgaggacaccgccagtggtacggggtcagta
acagctgccgactgctggcagcgggtggttcgcgttttccaatccaagaagttccagtcg
cgcaaactggagcgtctctaccagcgctacttcttcaggcttaaccagagttcgctaaca
atttttgtctgtggccatggccttgtttttggcacttatggtggtgtgcaatcgaaatgg
cttccaccaggactacatgtggatggtcagctatctggtcattggagtgctaattatagt
gcaggtattcggggtgctaatggtggctccccgcagtgcctcggaggggatctggtggtc
cgtcttcttcatctacattatctatacgctgctgccggtgcggatgagagcggcggtgct
cagcggggagtgctgtcagctatacacctcctcaccacatggaggatcaatcaggacgat
gagttcctctggaaacagctaagcgcaaacgtgttgatcttcctgtgcaccaacatcatt
gggatctgcacacattacccagcagaggtgtctcagagacaggcctttcaggagacacgt
ggatacatccaggcccgactgcacctgcagagagaaaaccagcagcaggagcgcctgttg
ctgtctgtcttgccgaggcatgttgccatggagatgaaggctgacatcaacgctaaaaaa
gaagacatgatgtttcacaagatctacatccagaagcacgacaatgtcagtattctgttt
gcagacatcgagggattcactagtctggcgtctcagtgcactgctcaggagctggtcatg
actctaaacgagctgttcgcccgctttgacaaactagcatcggagaaccactgcttgcgg
atcaagattctaggggattgttattactgtgtgtctggtttgccggagcccagagcagat
catgctcactgctgtgtggagatgggggtcgacatgatcgaagccatttctctggtgcga
gaggtgacgggggtgaacgtgaacatgcgggtgggtattcacagcggtcgtgttcactgt
ggtgttcttggattgagaaaatggcaattcgatgtgtggtccaacgacgtaacactcgcc
aaccacatggaagctggaggcaaagctgggaggatccacatcactaaagcgactctacag
tacctgaatggagactatgaggtggagccgggtttcggaggggagagaaacgcatacctg
aaggagaacagcattgagacgttcctcgtgctgggctgcagtcagaagaggaaagacgag
aaggccatgatggccaagatgcagcgcacgaggaccaactctaatgaagctctggtgccg
cggtgggtgcccgacagatccttctccaggaccaaagactccaaagtcttcagacagatg
ggcattgatgaaacctccagcaaagacaaccgtggtgctcaggaggcgttgaaccccgag
gatgaggtcgatgagtttttgggtcgtgccatcgacgctcgcagtattgaccagctccgc
aaagaccatgtcaagaagttcctcctcaccttccaaacctccagcctggagaagaagtat
gctaagaaggttgatgatcgttttggtggttacgtggcctgtacgctcctggtcttctgt
ttcatctcttttatccagatcgtcgtattccctcatactctggtcatgctgggaatttac
atcagtatcttcatcattcttgccaacatcctctttatctgtgccatttactcctgtgtg
aagctcttccccgctgccatgcaaactgtgtccaagaagattgttcagtctcgcaccaac
agcacactggtgggagttttcaccatcatcctcgtcttcatctctgcctttgtcaatatg
ttttcctgtgatacgcagaagctggtggactgtgtggcaaagcagttgaactggtcttca
gagatggtgactccttgtatcattcacaatatgtctcgatctgtagccgatggcctgagt
atttgtcccaacaacactccttcctgcccttttcctgagtatttcagctacagtgtgctg
ctgacgctgctggcctgctcagtgtttctgcagatcagtagtatagggaagctggcttta
atgctgctcatccagctcaccttcctgctgcttgtggagtggccagaggtggcgctgttc
gacaacgcagacctcttcgtcactgccaatgcccttgttttcaacgaaacactgcaatgg
tccaatttcaatacgactactgaacagtgcactttcagggtgactaaagtgtccctaaag
gtcatgaccccagtgatcctcactgtatttgtactagcactgtacctacatgcccagcaa
gtggagtcaacagcccgtctagacttcctttggaagcttcaggccacagaagagaaggag
gagatggaggaacttcaagcctacaaccgccggctactccacaacatcctgcccaaagac
gtggctgcgcactttctggcccgagagcgaaggaatgacgagctatattatcagtcgtgc
gagtgtgtggccgtcatgttcgcctccattagcaatttctctgagttctacgtggagctg
gaggccaataacgagggagtggagtgtctgaggctcctcaatgagatcatcgctgacttt
gatgagatcatcagtgaagagaagtacaggcagctggagaaaataaagaccattggcagc
acctacatggccgcatcaggcctcaatgactccacatatgacaaggaaggccgttcgcat
ataacagcgttggctgactacgccatgcacctccgcgaacagatgaaatacatcaatgag
cattccttcaacaacttccagatgaagatcggactgaacattgggccagtggtcgcaggt
gttattggagccaggaagccccagtatgatatttggggaaacacagtaaacgtggccagt
cggatggacagtacgggagtcccagaccgtattcaggtgaccacagatctacaccaggtg
ttgcacagtaaaggttaccagctggagtgtcgaggggtcataaaggtgaagggtaagggt
gaaatgaccacttacttcctgaacgacggacctcccaacagttag

DBGET integrated database retrieval system