KEGG   Danio rerio (zebrafish): 570652Help
Entry
570652            CDS       T01004                                 

Gene name
adcy6a
Definition
(RefSeq) adenylate cyclase type 6 isoform X1
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre04114  Oocyte meiosis
dre04261  Adrenergic signaling in cardiomyocytes
dre04270  Vascular smooth muscle contraction
dre04371  Apelin signaling pathway
dre04540  Gap junction
dre04912  GnRH signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04916  Melanogenesis
Module
dre_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    570652 (adcy6a)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    570652 (adcy6a)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    570652 (adcy6a)
  Cellular community - eukaryotes
   04540 Gap junction
    570652 (adcy6a)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    570652 (adcy6a)
   04914 Progesterone-mediated oocyte maturation
    570652 (adcy6a)
   04916 Melanogenesis
    570652 (adcy6a)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    570652 (adcy6a)
   04270 Vascular smooth muscle contraction
    570652 (adcy6a)
Enzymes [BR:dre01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     570652 (adcy6a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA
Motif
Other DBs
NCBI-GeneID: 570652
NCBI-ProteinID: XP_017209219
ZFIN: ZDB-GENE-060221-1
Ensembl: ENSDARG00000061445
Vega: OTTDARG00000030416
UniProt: E7FEP5
Position
23
AA seq 1203 aa AA seqDB search
MSWINGFLVARVDDRKTAWGERNGKKSKRKVGSSLCNPRYMSCLRDVEAMEPPPQPPHAQ
ATRSGGPGGGPGGGPGGTGNFGMRCGWQEDHYGKMGSGGEGVGLKSVDLGFEDGDVKGRK
RDGLGGDGSSEDTASGTGSVTAADCWQRVVRVFQSKKFQSRKLERLYQRYFFRLNQSSLT
MLMGVLVIVCGVMLTFHCIHGPPDVVYASVLSVAMALFLALMVVCNRNGFHQDYMWMVSY
LVIGVLIIVQVFGVLMVAPRSASEGIWWSVFFIYIIYTLLPVRMRAAVLSGGVLSAIHLL
TTWRINQDDEFLWKQLSANVLIFLCTNIIGICTHYPAEVSQRQAFQETRGYIQARLHLQR
ENQQQERLLLSVLPRHVAMEMKADINAKKEDMMFHKIYIQKHDNVSILFADIEGFTSLAS
QCTAQELVMTLNELFARFDKLASENHCLRIKILGDCYYCVSGLPEPRADHAHCCVEMGVD
MIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGR
IHITKATLQYLNGDYEVEPGFGGERNAYLKENSIETFLVLGCSQKRKDEKAMMAKMQRTR
TNSNEALVPRWVPDRSFSRTKDSKVFRQMGIDETSSKDNRGAQEALNPEDEVDEFLGRAI
DARSIDQLRKDHVKKFLLTFQTSSLEKKYAKKVDDRFGGYVACTLLVFCFISFIQIVVFP
HTLVMLGIYISIFIILANILFICAIYSCVKLFPAAMQTVSKKIVQSRTNSTLVGVFTIIL
VFISAFVNMFSCDTQKLVDCVAKQLNWSSEMVTPCIIHNMSRSVADGLSICPNNTPSCPF
PEYFSYSVLLTLLACSVFLQISSIGKLALMLLIQLTFLLLVEWPEVALFDNADLFVTANA
LVFNETLQWSNFNTTTEQCTFRVTKVSLKVMTPVILTVFVLALYLHAQQVESTARLDFLW
KLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIS
NFSEFYVELEANNEGVECLRLLNEIIADFDEIISEEKYRQLEKIKTIGSTYMAASGLNDS
TYDKEGRSHITALADYAMHLREQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDI
WGNTVNVASRMDSTGVPDRIQVTTDLHQVLHSKGYQLECRGVIKVKGKGEMTTYFLNDGP
PNS
NT seq 3612 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggatcaacggcttcctagtggccagagtggatgaccgaaagaccgcgtggggc
gagcgcaatggcaagaagtccaagcgcaaggttggctcctctctctgcaacccacgctac
atgagctgcctgcgggacgtggaagccatggagcctcctccccagccgccccacgctcag
gccacccggtctggaggaccaggaggaggaccaggagggggaccagggggaacgggcaac
ttcggcatgcgctgcggatggcaggaagaccactatggcaaaatgggaagcgggggggag
ggtgtggggcttaaatctgtggacctgggcttcgaggatggcgatgttaaagggcggaaa
agggacggtttgggtggtgacggctccagcgaggacaccgccagtggtacggggtcagta
acagctgccgactgctggcagcgggtggttcgcgttttccaatccaagaagttccagtcg
cgcaaactggagcgtctctaccagcgctacttcttcaggcttaaccagagttcgctaaca
atgctaatgggcgttttggtgatcgtctgcggggtcatgctcaccttccactgcattcat
ggcccaccagacgtagtttacgcttcagttttgtctgtggccatggccttgtttttggca
cttatggtggtgtgcaatcgaaatggcttccaccaggactacatgtggatggtcagctat
ctggtcattggagtgctaattatagtgcaggtattcggggtgctaatggtggctccccgc
agtgcctcggaggggatctggtggtccgtcttcttcatctacattatctatacgctgctg
ccggtgcggatgagagcggcggtgctcagcggaggagtgctgtcagctatacacctcctc
accacatggaggatcaatcaggacgatgagttcctctggaaacagctaagcgcaaacgtg
ttgatcttcctgtgcaccaacatcattgggatctgcacacattacccagcagaggtgtct
cagagacaggcctttcaggagacacgtggatacatccaggcccgactgcacctgcagaga
gaaaaccagcagcaggagcgcctgttgctgtctgtcttgccgaggcatgttgccatggag
atgaaggctgacatcaacgctaaaaaagaagacatgatgtttcacaagatctacatccag
aagcacgacaatgtcagtattctgtttgcagacatcgagggattcactagtctggcgtct
cagtgcactgctcaggagctggtcatgactctaaacgagctgttcgcccgctttgacaaa
ctagcatcggagaaccactgcttgcggatcaagattctaggggattgttattactgtgtg
tctggtttgccggagcccagagcagatcatgctcactgctgtgtggagatgggggtcgac
atgatcgaagccatttctctggtgcgagaggtgacgggggtgaacgtgaacatgcgggtg
ggtattcacagcggtcgtgttcactgtggtgttcttggattgagaaaatggcaattcgat
gtgtggtccaacgacgtaacactcgccaaccacatggaagctggaggcaaagctgggagg
atccacatcactaaagcgactctacagtacctgaatggagactatgaggtggagccgggt
ttcggaggggagagaaacgcatacctgaaggagaacagcattgagacgttcctcgtgctg
ggctgcagtcagaagaggaaagacgagaaggccatgatggccaagatgcagcgcacgagg
accaactctaatgaagctctggtgccgcggtgggtgcccgacagatccttctccaggacc
aaagactccaaagtcttcagacagatgggcattgatgaaacctccagcaaagacaaccgt
ggtgctcaggaggcgttgaaccccgaggatgaggtcgatgagtttttgggtcgtgccatc
gacgctcgcagtattgaccagctccgcaaagaccatgtcaagaagttcctcctcaccttc
caaacctccagcctggagaagaagtatgctaagaaggttgatgatcgttttggtggttac
gtggcctgtacgctcctggtcttctgtttcatctcttttatccagatcgtcgtattccct
catactctggtcatgctgggaatttacatcagtatcttcatcattcttgccaacatcctc
tttatctgtgccatttactcctgtgtgaagctcttccccgctgccatgcaaactgtgtcc
aagaagattgttcagtctcgcaccaacagcacactggtgggagttttcaccatcatcctc
gtcttcatctctgcctttgtcaatatgttttcctgtgatacgcagaagctggtggactgt
gtggcaaagcagttgaactggtcttcagagatggtgactccttgtatcattcacaatatg
tctcgatctgtagccgatggcctgagtatttgtcccaacaacactccttcctgccctttt
cctgagtatttcagctacagtgtgctgctgacgctgctggcctgctcagtgtttctgcag
atcagtagtatagggaagctggctttaatgctgctcatccagctcaccttcctgctgctt
gtggagtggccagaggtggcgctgttcgacaacgcagacctcttcgtcactgccaatgcc
cttgttttcaacgaaacactgcaatggtccaatttcaatacgactactgaacagtgcact
ttcagggtgactaaagtgtccctaaaggtcatgaccccagtgatcctcactgtatttgta
ctagcactgtacctacatgcccagcaagtggagtcaacagcccgtctagacttcctttgg
aagcttcaggccacagaagagaaggaggagatggaggaacttcaagcctacaaccgccgg
ctactccacaacatcctgcccaaagacgtggctgcgcactttctggcccgagagcgaagg
aatgacgagctatattatcagtcgtgcgagtgtgtggccgtcatgttcgcctccattagc
aatttctctgagttctacgtggagctggaggccaataacgagggagtggagtgtctgagg
ctcctcaatgagatcatcgctgactttgatgagatcatcagtgaagagaagtacaggcag
ctggagaaaataaagaccattggcagcacctacatggccgcatcaggcctcaatgactcc
acatatgacaaggaaggccgttcgcatataacagcgttggctgactacgccatgcacctc
cgcgaacagatgaaatacatcaatgagcattccttcaacaacttccagatgaagatcgga
ctgaacattgggccagtggtcgcaggtgttattggagccaggaagccccagtatgatatt
tggggaaacacagtaaacgtggccagtcggatggacagtacgggagtcccagaccgtatt
caggtgaccacagatctacaccaggtgttgcacagtaaaggttaccagctggagtgtcga
ggggtcataaaggtgaagggtaagggtgaaatgaccacttacttcctgaacgacggacct
cccaacagttag

DBGET integrated database retrieval system