KEGG   Danio rerio (zebrafish): 570901Help
Entry
570901            CDS       T01004                                 

Gene name
smug1
Definition
(RefSeq) single-strand selective monofunctional uracil DNA glycosylase
  KO
K10800  single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    570901 (smug1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     570901 (smug1)
DNA repair and recombination proteins [BR:dre03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     570901 (smug1)
 Prokaryotic Type
     570901 (smug1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4918 UDG
Motif
Other DBs
NCBI-GeneID: 570901
NCBI-ProteinID: XP_017213755
ZFIN: ZDB-GENE-030131-9473
Ensembl: ENSDARG00000101308
Vega: OTTDARG00000043224
Position
11
AA seq 277 aa AA seqDB search
MLAQLDTERLESGDASKREVPDLAVERLFNSSTAASRFLQAELELNARLQMLSFGNPVRY
TYNPLEYAWETHQCYVENYCQEGQSVLFLGMNPGPFGMAQTGVPFGEVKAVRNWLKITGR
VGRPADEHPKRRITGLDCTQSEVSGARFWGFFQELCGEPNNFFRHCFVHNLCPLIFMSES
GKNLTPPELPAAERDALLSCCDSALCRVVTALGISMVIGVGKLSEQRARRALSEAGISVR
VEGIMHPSPRNPLANKGWASVARDKLDQLGVLGLLTR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgttagcacagctcgatacagagaggttggaaagtggagatgcatctaagagagaagtg
cctgatctggctgttgagcggctcttcaacagctccacagccgcttcccggttcttgcag
gctgagctggagctgaacgcccggctgcagatgctgtcctttggaaatcccgtgcggtac
acgtacaaccccctggagtacgcctgggagactcatcagtgttatgtggagaattactgt
caggaggggcagagtgtcctctttctgggcatgaacccgggacccttcggcatggcacaa
actggggttccattcggggaagtgaaagcggttcgcaattggctgaagatcacgggaagg
gtggggcgtccggcagacgagcacccgaagcggcgaatcacaggcctggactgcactcag
agtgaagtgagcggcgctcggttctggggctttttccaggagctctgcggagaaccgaac
aacttcttccgccactgttttgtgcacaacttgtgtcctctgatcttcatgagtgagtcc
ggcaagaacttgacccctcccgagctcccggcggcagagcgagacgctctcctgtcctgc
tgtgactctgccctctgtcgggtcgtcacagcactgggcatctccatggtgatcggggtg
gggaaactgtcagagcagcgtgcccgacgagcgctctcagaggcgggcatcagcgtcagg
gtggaaggcatcatgcatccatcccctagaaacccactggctaataaaggctgggcgagt
gtagcccgagataaactagatcagctgggggttttgggtttgctgactagatga

DBGET integrated database retrieval system