KEGG   Danio rerio (zebrafish): 570913Help
Entry
570913            CDS       T01004                                 

Gene name
ugt5g1, zgc:175099
Definition
UDP glucuronosyltransferase 5 family, polypeptide G1
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dre  Danio rerio (zebrafish)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    570913 (ugt5g1)
   00053 Ascorbate and aldarate metabolism
    570913 (ugt5g1)
   00500 Starch and sucrose metabolism
    570913 (ugt5g1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    570913 (ugt5g1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    570913 (ugt5g1)
   00860 Porphyrin and chlorophyll metabolism
    570913 (ugt5g1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    570913 (ugt5g1)
   00982 Drug metabolism - cytochrome P450
    570913 (ugt5g1)
   00983 Drug metabolism - other enzymes
    570913 (ugt5g1)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     570913 (ugt5g1)
Glycosyltransferases [BR:dre01003]
 Others
  Hydrophobic molecule
   570913 (ugt5g1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
7
AA seq 528 aa AA seqDB search
MDMSSKWLSALTCLLSVVCCCHGGNILVFPEDGSHWVNMQVILRKLHTHGHSFTVVRSSK
SWYIHENSALYNTITVNPVETEDVGQDYFNMLLDRSLALQKMSPLVRFFEQQKDITTVLK
VFHNGVLRMVSAMLDDAELVKSLREAKFDLLLTDPAFPAGVLVANFLQLPMVYNVRWLNA
GDAHMQTAPSPPSYVPMYNSLLHDQMSFLQRVENFLRYLCSLLQERYVIVPIYRELLERH
FPPGSDLLSMQQSADIWLMRMDFVFDFPRPTMPNIIYMGGFQCKPAQALPVDLEEFMQSS
GEHGVVFMSLGAMVGALPRTITEAIASAFAKIPQKVMWRYHGERPSTLGNNTLLLEWFPQ
NDLLGHPKTRAFVSHGGTNGIYEAIYHGVPVLALPLLFDQFDNVMRLQVRNAARVLQVAT
LTSQEFLEGLKDVLENPLYRSSIRKMSELHRDQPISPLDSATFWIEYVMRHKGAAHLRSE
ANNLAWYSYHSLDVLVFLLAIAVIAFWTSVYVCRFLCCRKSIKKRKVD
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggatatgagctccaaatggttatctgcactgacttgccttttgtctgtggtctgctgc
tgtcatggtggaaatatcctggtgtttccagaggacggcagccattgggtgaacatgcaa
gtcattttaaggaagctccacacccacggccatagctttacagtggtgcgttcatctaaa
agttggtacatccatgagaactcagctctctacaacaccatcaccgtcaacccagtggag
accgaagacgttggtcaggattactttaacatgctgttagacaggtcgctagcactgcaa
aagatgtcgccgttggttcgtttcttcgaacagcagaaagatatcaccaccgttttgaag
gtgtttcacaatggggtactccgaatggtttcagccatgttggatgatgcagagcttgtc
aagagcttgcgagaagctaaatttgacctgttgctaacagatcctgcgttcccggctgga
gtcctggtagccaatttcctccagctacccatggtttacaatgtacgctggctgaatgcg
ggtgatgctcacatgcaaactgctccatctcctccatcctacgtcccgatgtacaactca
ctactccatgaccaaatgagcttcctacagcgagtggaaaatttcctacgctatctatgt
agcctccttcaggagcgatacgtaattgtgccaatttacagagaactgcttgaacgtcac
ttcccgcctggaagtgatcttctgtctatgcagcaatctgctgatatttggttgatgaga
atggactttgtttttgattttccaaggcccaccatgccaaacatcatctacatgggtggc
tttcagtgtaagccggctcaagcacttccagtggatctagaagagttcatgcagagctcc
ggcgaacatggagtagtcttcatgtctttgggagcaatggtcggcgctcttcctagaaca
attacagaggccattgcttcagcatttgctaagatccctcagaaagtcatgtggcggtat
catggagaacggccttcaactttgggtaacaacactttacttttagagtggtttccgcag
aatgatctcctgggccatccaaagactcgcgcatttgtatctcatggtggcaccaatggt
atctacgaagctatttaccatggagtccctgttttggctttgccgctcctctttgaccag
tttgacaatgtcatgcgactccaggttcgaaatgcagctcgagtgcttcaagtcgcaact
cttacatctcaagaatttcttgaaggcctcaaagacgttcttgagaacccactgtaccga
agtagcatccgcaaaatgtcagaactgcatcgtgatcaacccatctctcctcttgatagt
gccactttttggattgaatatgtaatgaggcacaaaggcgcagctcaccttcgttcagag
gctaacaatttggcttggtactcataccacagtcttgatgtgttggtgtttcttttggca
atcgctgtgattgctttttggacgtcagtgtatgtctgcagatttttgtgttgcaggaaa
tcaatcaagaagaggaaggtagactga

DBGET integrated database retrieval system