KEGG   Danio rerio (zebrafish): 571561Help
Entry
571561            CDS       T01004                                 

Definition
UDP-glucuronosyltransferase 2B20-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dre  Danio rerio (zebrafish)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    571561
   00053 Ascorbate and aldarate metabolism
    571561
   00500 Starch and sucrose metabolism
    571561
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    571561
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    571561
   00860 Porphyrin and chlorophyll metabolism
    571561
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    571561
   00982 Drug metabolism - cytochrome P450
    571561
   00983 Drug metabolism - other enzymes
    571561
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     571561
Glycosyltransferases [BR:dre01003]
 Others
  Hydrophobic molecule
   571561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 443 aa AA seqDB search
MRLVVCVLALLTAFSAGECGNVLVWFTEGSHWINLKIVLETLIDRGHNVTVLVPDASIFM
HEKESDRFSYQHFSVSKSTQDMQDSLNDFLHFSMYEMDRLNLLQIHIRLYQLISKDQQLC
LAYCNGALKSPELMDKLLQEKFDVMLADPIFPCRRPTSYCEMMGKADIWLIRTYWDFEFP
RPFLPNFKFIGGIHCTPAKPLPKDLEEFVQSSGDDGIVVFTLGSMVNNITKERSNTIASA
LAQIPQKVLWRYGGEKPDTLGENTRIFEWMPQNDLLGHPKTRAFITHGGTNGIYEAIYHG
VPMVGIPLFGDQPDNMVHMKTRGAAVVMDFNSMQTQDLVDGLNAVINDPSYKENAMRLSR
IHHDRPMKPLDESVFWIEFVMRNKGAKHLRVEAHNLTWYQYHCLDVFAFLTTVLTLVLYI
CFKMAKFFIMRCCFRSKRKSKKE
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgagactcgtagtgtgtgttcttgctcttctcactgcgttcagcgctggagaatgtggg
aatgttttggtttggtttacagagggcagccactggattaatctgaagattgttttggaa
acgttgattgacaggggacacaatgttacagtgttggttcctgatgcttcaatcttcatg
catgaaaaagaatcagatcgcttctcctaccagcacttcagcgtgtccaaatctacacag
gacatgcaagattccttaaatgatttcttacatttctccatgtatgagatggatcggtta
aacttgctgcaaattcatatcagattataccagcttatttctaaagatcaacaactgtgt
cttgcttactgcaacggtgctctgaaatccccagaactgatggacaaattgctgcaagag
aagtttgatgtcatgctggctgatccgatttttccatgcaggcgacctacttcctattgt
gagatgatgggtaaagccgatatctggttaatcagaacctactgggattttgagtttccg
cggccattcctacccaactttaaattcatcggagggattcattgcacccctgccaagcca
ttacccaaggatttagaggagtttgtgcagagctcaggggatgatgggattgtggtcttc
acactgggatccatggtaaacaacattaccaaagaaaggagcaatacaatcgcctccgca
ctggcacagataccacagaaggtcttgtggcgatacggtggagagaaaccagatactctt
ggtgaaaacactagaatctttgagtggatgcctcagaatgacttattaggtcaccccaaa
accagagcgttcatcactcacgggggcactaatggcatatatgaggccatatatcatggt
gtcccgatggtcggcatccccttgtttggtgaccagcctgataatatggttcatatgaag
accagaggtgctgctgttgtcatggactttaacagcatgcagactcaagacctggtggat
ggacttaatgctgtcattaatgacccctcgtataaagagaatgcaatgcgtttgtccagg
attcatcacgacagaccaatgaagcctttagatgagtctgtgttctggattgagttcgtc
atgcgcaataaaggtgcaaaacacctgcgtgtggaggcccacaacctgacctggtatcag
taccactgtctggatgtgttcgcttttcttaccactgtcctgactctagtcctctacatc
tgctttaaaatggccaaattcttcatcatgcgctgctgctttagatcaaagaggaaaagc
aagaaagagtga

DBGET integrated database retrieval system