KEGG   Danio rerio (zebrafish): 571753Help
Entry
571753            CDS       T01004                                 

Gene name
ppp1cc, fe06g11, fi22e08, wu:fe06g11, wu:fi22e08
Definition
protein phosphatase 1, catalytic subunit, gamma isozyme
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dre  Danio rerio (zebrafish)
Pathway
mRNA surveillance pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Focal adhesion
Regulation of actin cytoskeleton
Insulin signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    571753 (ppp1cc)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    571753 (ppp1cc)
  Cell growth and death
   04114 Oocyte meiosis
    571753 (ppp1cc)
  Cellular commiunity
   04510 Focal adhesion
    571753 (ppp1cc)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    571753 (ppp1cc)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    571753 (ppp1cc)
   04270 Vascular smooth muscle contraction
    571753 (ppp1cc)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    571753 (ppp1cc)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     571753 (ppp1cc)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     571753 (ppp1cc)
Transcription machinery [BR:dre03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     571753 (ppp1cc)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     571753 (ppp1cc)
Spliceosome [BR:dre03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    571753 (ppp1cc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
5
AA seq 323 aa AA seqDB search
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECRRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNPSRPVTPPRNMVTKQAKK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctgacatcgacaaactcaacatagacagcatcattcagcgcctgctcgaggtgaga
gggtcgaagcctggtaagaacgttcagctgcaggagaacgagattcgaggattgtgttta
aagtctcgtgagattttcctcagtcagcccatcctgctggagctcgaagcgccgctcaag
atctgcggtgacatccacggtcagtactatgacctgctccggctcttcgagtatggagga
tacccacctgagagtaattacctgttcctgggagattatgttgaccgagggaagcagtct
ctggagaccatctgtctgctgctggcctacaagatcaaatacccggagaacttctttctg
ctgagggggaatcacgagtgcgcctccatcaaccgcatctacggcttctacgacgaatgc
aggagacgctacaacatcaagctctggaagacttttacagactgcttcaactgtctgccg
atcgccgccatcgtggacgagaagatcttctgctgtcacggaggtttgtctccagatctg
cagtctatggagcagatcagacggatcatgcggcccacagacgtgccggatcagggtctg
ctgtgtgacctgctgtggtcagaccctgataaagatgtgttgggctggggagagaacgac
agaggagtctcctttacattcggagctgaagtagtggcaaaattcctgcacaaacatgac
ctggatttgatctgcagagcccaccaggtggttgaggacggatatgagtttttcgccaag
cgtcagctggtcactctgttttctgcacccaattactgtggagaattcgacaacgctgga
gccatgatgagcgtggacgagaccctcatgtgctctttccagatcctgaaacctgcagag
aagaagaagccaaaccccagccgtccagtgactccaccgagaaacatggtcaccaagcag
gccaagaaatga

DBGET integrated database retrieval system