KEGG   Danio rerio (zebrafish): 571834Help
Entry
571834            CDS       T01004                                 

Gene name
im:7142218
Definition
si:dkey-28b4.7
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
dre  Danio rerio (zebrafish)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    571834 (im:7142218)
   00240 Pyrimidine metabolism
    571834 (im:7142218)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    571834 (im:7142218)
   03410 Base excision repair
    571834 (im:7142218)
   03420 Nucleotide excision repair
    571834 (im:7142218)
   03430 Mismatch repair
    571834 (im:7142218)
   03440 Homologous recombination
    571834 (im:7142218)
DNA repair and recombination proteins [BR:dre03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      571834 (im:7142218)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
1
AA seq 117 aa AA seqDB search
MTISYQRPDMTPKRGLITDTFKVVKKARRGGKRSKSPSPPKAEPEPPQLSEREKDIQELK
NFDLDWKFGPCTGISRLQRWERAALHGLNPPQEIKDILLKEDTDPEYTQSLWRDYPF
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgacgatatcctatcagcgtccagatatgacaccaaagcgtggcctcatcaccgacacc
tttaaggttgtgaagaaggcaaggagaggaggcaagagaagcaagtctccttcaccaccg
aaagcagagcctgaacccccacaactgagtgaaagagaaaaagatatacaggagctgaag
aactttgatctggattggaagtttggaccatgcacagggatcagtcgactgcagagatgg
gagagggcagcactgcatgggctgaatcccccgcaggagattaaagacattttgctgaag
gaggacactgacccagagtacacacagagtctctggcgtgactatcctttctga

DBGET integrated database retrieval system