KEGG   Danio rerio (zebrafish): 572074Help
Entry
572074            CDS       T01004                                 

Gene name
prkaa2
Definition
protein kinase, AMP-activated, alpha 2 catalytic subunit
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dre04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dre04150]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:dre04140]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:dre04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:dre04920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Position
20
AA seq 553 aa AA seqDB search
MAEKQKHEGRVKIGHYILGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEDAEARRLF
QQIISAVDYCHRHMVVHRDLKPENVLLDGNMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
VASLLMLMLQVDPLKRATIKDIREHEWFKQDLPGYLFPEDPSYDATVVDEEAVREVCEKF
ECTEAEVLSSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPTSSFMEEGMPLPP
GVKPHPERMPPLLADSPKARCPLDALNTTRPKPLAVKKAKWHLGIRSQSKPYDIMAEVYR
AMKQLEYEWKVVNPYHLRVRRKNPVTGNFVKMSLQLYQVDNRSYLLDFKSIDDDIMEHKS
GSSTPQRSGSTAGLLRPRLSIDSASVVAMEMPQLSSSLPGSLTGSTPLLTPRQGSHTMDF
FEMCASLITTLAR
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaagcagaaacacgaaggcagggtaaagataggacactacatcctcggagac
acgctcggagtcggaacatttggaaaagtgaagattggagagcatcagctaactggccat
aaagttgctgtgaagatcctcaacagacagaagatccgaagtctcgatgttgtgggcaaa
atcaaacgagagattcagaaccttaagctcttcagacatccacacatcatcaagctgtat
caggtgatcagcactcccacagactttttcatggtcatggagtacgtgtccggaggcgaa
ctctttgattatatttgcaagcatgggagggtggaggatgccgaggccaggcgtctgttc
cagcagatcatctcagctgtggattactgccacagacacatggtggtgcacagagacctc
aagccagagaatgtgctgctggatggcaacatgaatgccaagatcgctgactttggtctg
tcaaacatgatgtcagacggagagttcctcaggacaagctgcggatcaccaaactacgcc
gcaccagaggtcatatccggaaggctgtatgctggtccagaggtggacatctggagctgt
ggtgttattctctatgcactgctttgcgggacgctgccgtttgatgatgaacatgtgccc
actctcttcaaaaagatccgtggaggggttttctacatccccgaatacctcaaccgctct
gtggccagtctgctgatgctcatgctgcaggtggacccgctgaagagagctactatcaaa
gacatcagagagcatgaatggttcaaacaggatcttcctggctacctgttccctgaggac
ccctcatatgatgccacagtagtggatgaggaggccgtgcgtgaggtgtgtgagaagttt
gaatgcactgaagctgaagtgctgagcagcctgtacagcggagaccctcaagaccagctg
gcggtggcgtatcacctaatcatcgacaaccggcggatcatgaaccaggccagcgagttt
tacctggcttctagtcccccgaccagctccttcatggaggagggcatgcctctgccacct
ggagtcaaacctcaccctgaacgcatgccgccactgctggccgacagccctaaagcacgt
tgccccctggatgccctgaacaccactagacccaaaccgctggccgtcaagaaggcaaag
tggcacctgggcatccggagccagagcaaaccctacgacatcatggcagaggtttacaga
gccatgaaacagctggagtacgagtggaaagtggtgaacccgtatcacctaagagtgcgc
cggaagaatcctgtcacagggaatttcgtgaaaatgagtctgcagctctaccaggtggac
aatcgcagctacctgctcgactttaagagcattgacgatgatataatggagcacaagtca
ggctcgtcgacaccgcagcgctccggctctacagcgggtctacttcgtccgcggctcagc
atcgactcagcgtccgtggtggcgatggagatgccacagctcagcagttctctgcccggc
tctctgaccggaagcacacccctactgaccccacgccagggcagccacactatggacttc
ttcgagatgtgtgccagcctcatcaccacactggcccgctga

DBGET integrated database retrieval system