KEGG   Danio rerio (zebrafish): 572074Help
Entry
572074            CDS       T01004                                 

Gene name
prkaa2
Definition
protein kinase, AMP-activated, alpha 2 catalytic subunit
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    572074 (prkaa2)
   04150 mTOR signaling pathway
    572074 (prkaa2)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    572074 (prkaa2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    572074 (prkaa2)
   04920 Adipocytokine signaling pathway
    572074 (prkaa2)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     572074 (prkaa2)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   572074 (prkaa2)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    572074 (prkaa2)
  Mitophagy factors
   Other mitophagy factors
    572074 (prkaa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Position
20
AA seq 553 aa AA seqDB search
MAEKQKHEGRVKIGHYILGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEDAEARRLF
QQIISAVDYCHRHMVVHRDLKPENVLLDGNMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
VASLLMLMLQVDPLKRATIKDIREHEWFKQDLPGYLFPEDPSYDATVVDEEAVREVCEKF
ECTEAEVLSSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPTSSFMEEGMPLPP
GVKPHPERMPPLLADSPKARCPLDALNTTRPKPLAVKKAKWHLGIRSQSKPYDIMAEVYR
AMKQLEYEWKVVNPYHLRVRRKNPVTGNFVKMSLQLYQVDNRSYLLDFKSIDDDIMEHKS
GSSTPQRSGSTAGLLRPRLSIDSASVVAMEMPQLSSSLPGSLTGSTPLLTPRQGSHTMDF
FEMCASLITTLAR
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaagcagaaacacgaaggcagggtaaagataggacactacatcctcggagac
acgctcggagtcggaacatttggaaaagtgaagattggagagcatcagctaactggccat
aaagttgctgtgaagatcctcaacagacagaagatccgaagtctcgatgttgtgggcaaa
atcaaacgagagattcagaaccttaagctcttcagacatccacacatcatcaagctgtat
caggtgatcagcactcccacagactttttcatggtcatggagtacgtgtccggaggcgaa
ctctttgattatatttgcaagcatgggagggtggaggatgccgaggccaggcgtctgttc
cagcagatcatctcagctgtggattactgccacagacacatggtggtgcacagagacctc
aagccagagaatgtgctgctggatggcaacatgaatgccaagatcgctgactttggtctg
tcaaacatgatgtcagacggagagttcctcaggacaagctgcggatcaccaaactacgcc
gcaccagaggtcatatccggaaggctgtatgctggtccagaggtggacatctggagctgt
ggtgttattctctatgcactgctttgcgggacgctgccgtttgatgatgaacatgtgccc
actctcttcaaaaagatccgtggaggggttttctacatccccgaatacctcaaccgctct
gtggccagtctgctgatgctcatgctgcaggtggacccgctgaagagagctactatcaaa
gacatcagagagcatgaatggttcaaacaggatcttcctggctacctgttccctgaggac
ccctcatatgatgccacagtagtggatgaggaggccgtgcgtgaggtgtgtgagaagttt
gaatgcactgaagctgaagtgctgagcagcctgtacagcggagaccctcaagaccagctg
gcggtggcgtatcacctaatcatcgacaaccggcggatcatgaaccaggccagcgagttt
tacctggcttctagtcccccgaccagctccttcatggaggagggcatgcctctgccacct
ggagtcaaacctcaccctgaacgcatgccgccactgctggccgacagccctaaagcacgt
tgccccctggatgccctgaacaccactagacccaaaccgctggccgtcaagaaggcaaag
tggcacctgggcatccggagccagagcaaaccctacgacatcatggcagaggtttacaga
gccatgaaacagctggagtacgagtggaaagtggtgaacccgtatcacctaagagtgcgc
cggaagaatcctgtcacagggaatttcgtgaaaatgagtctgcagctctaccaggtggac
aatcgcagctacctgctcgactttaagagcattgacgatgatataatggagcacaagtca
ggctcgtcgacaccgcagcgctccggctctacagcgggtctacttcgtccgcggctcagc
atcgactcagcgtccgtggtggcgatggagatgccacagctcagcagttctctgcccggc
tctctgaccggaagcacacccctactgaccccacgccagggcagccacactatggacttc
ttcgagatgtgtgccagcctcatcaccacactggcccgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system