KEGG   Danio rerio (zebrafish): 572074Help
Entry
572074            CDS       T01004                                 

Gene name
prkaa2
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04068  FoxO signaling pathway
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04371  Apelin signaling pathway
dre04530  Tight junction
dre04910  Insulin signaling pathway
dre04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    572074 (prkaa2)
   04068 FoxO signaling pathway
    572074 (prkaa2)
   04150 mTOR signaling pathway
    572074 (prkaa2)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    572074 (prkaa2)
  Cellular community - eukaryotes
   04530 Tight junction
    572074 (prkaa2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    572074 (prkaa2)
   04920 Adipocytokine signaling pathway
    572074 (prkaa2)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     572074 (prkaa2)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   572074 (prkaa2)
Membrane trafficking [BR:dre04131]
 Autophagy
  Other autophagy associated proteins
   Others
    572074 (prkaa2)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    572074 (prkaa2)
  Mitophagy factors
   Other mitophagy factors
    572074 (prkaa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo Haspin_kinase APH YukC
Motif
Other DBs
NCBI-GeneID: 572074
NCBI-ProteinID: XP_700831
ZFIN: ZDB-GENE-081120-5
UniProt: E7F9C4
Position
20
AA seq 553 aa AA seqDB search
MAEKQKHEGRVKIGHYILGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEDAEARRLF
QQIISAVDYCHRHMVVHRDLKPENVLLDGNMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
VASLLMLMLQVDPLKRATIKDIREHEWFKQDLPGYLFPEDPSYDATVVDEEAVREVCEKF
ECTEAEVLSSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPTSSFMEEGMPLPP
GVKPHPERMPPLLADSPKARCPLDALNTTRPKPLAVKKAKWHLGIRSQSKPYDIMAEVYR
AMKQLEYEWKVVNPYHLRVRRKNPVTGNFVKMSLQLYQVDNRSYLLDFKSIDDDIMEHKS
GSSTPQRSGSTAGLLRPRLSIDSASVVAMEMPQLSSSLPGSLTGSTPLLTPRQGSHTMDF
FEMCASLITTLAR
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaagcagaaacacgaaggcagggtaaagataggacactacatcctcggagac
acgctcggagtcggaacatttggaaaagtgaagattggagagcatcagctaactggccat
aaagttgctgtgaagatcctcaacagacagaagatccgaagtctcgatgttgtgggcaaa
atcaaacgagagattcagaaccttaagctcttcagacatccacacatcatcaagctgtat
caggtgatcagcactcccacagactttttcatggtcatggagtacgtgtccggaggcgaa
ctctttgattatatttgcaagcatgggagggtggaggatgccgaggccaggcgtctgttc
cagcagatcatctcagctgtggattactgccacagacacatggtggtgcacagagacctc
aagccagagaatgtgctgctggatggcaacatgaatgccaagatcgctgactttggtctg
tcaaacatgatgtcagacggagagttcctcaggacaagctgcggatcaccaaactacgcc
gcaccagaggtcatatccggaaggctgtatgctggtccagaggtggacatctggagctgt
ggtgttattctctatgcactgctttgcgggacgctgccgtttgatgatgaacatgtgccc
actctcttcaaaaagatccgtggaggggttttctacatccccgaatacctcaaccgctct
gtggccagtctgctgatgctcatgctgcaggtggacccgctgaagagagctactatcaaa
gacatcagagagcatgaatggttcaaacaggatcttcctggctacctgttccctgaggac
ccctcatatgatgccacagtagtggatgaggaggccgtgcgtgaggtgtgtgagaagttt
gaatgcactgaagctgaagtgctgagcagcctgtacagcggagaccctcaagaccagctg
gcggtggcgtatcacctaatcatcgacaaccggcggatcatgaaccaggccagcgagttt
tacctggcttctagtcccccgaccagctccttcatggaggagggcatgcctctgccacct
ggagtcaaacctcaccctgaacgcatgccgccactgctggccgacagccctaaagcacgt
tgccccctggatgccctgaacaccactagacccaaaccgctggccgtcaagaaggcaaag
tggcacctgggcatccggagccagagcaaaccctacgacatcatggcagaggtttacaga
gccatgaaacagctggagtacgagtggaaagtggtgaacccgtatcacctaagagtgcgc
cggaagaatcctgtcacagggaatttcgtgaaaatgagtctgcagctctaccaggtggac
aatcgcagctacctgctcgactttaagagcattgacgatgatataatggagcacaagtca
ggctcgtcgacaccgcagcgctccggctctacagcgggtctacttcgtccgcggctcagc
atcgactcagcgtccgtggtggcgatggagatgccacagctcagcagttctctgcccggc
tctctgaccggaagcacacccctactgaccccacgccagggcagccacactatggacttc
ttcgagatgtgtgccagcctcatcaccacactggcccgctga

DBGET integrated database retrieval system