KEGG   Danio rerio (zebrafish): 573207Help
Entry
573207            CDS       T01004                                 

Gene name
creb1a, creb1, zgc:55598
Definition
cAMP responsive element binding protein 1a
Orthology
K05870  
cyclic AMP-responsive element-binding protein 1
Organism
dre  Danio rerio (zebrafish)
Pathway
Adrenergic signaling in cardiomyocytes
Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    573207 (creb1a)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    573207 (creb1a)
Transcription factors [BR:dre03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    573207 (creb1a)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    573207 (creb1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
1
AA seq 318 aa AA seqDB search
MTMEAGADVQQGGDTAVSETDTQQIATLAQVSMAAAQASATAPTVTLVQLPNGQTVQVHG
VIQAAQPSVIQSPQVQTVQISTIAESDDSQESVDSVTDSQKRREILSRRPSYRKILNDLS
SDAPAVPRIEEEKSEEDSTPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQG
LQTLTMTNAAGAQPGTTILQYAQTSDGQQILVPSNQVVVQAASGDVQAYQIRTAAASTIA
PGVVMASSPALPSQGAEEATRKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNK
TLIEELKALKDLYCHKSE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggaggcaggagcagatgtccagcagggcggcgacactgcggtctcagagaca
gacactcagcagattgccaccttggcacaagtttccatggcggcagcacaggcatcagca
actgcacccacagtgaccttagttcagctgcccaatgggcaaacagtgcaagttcacggg
gtcatccaggcagcccagccctctgtcatacaatccccacaggtgcaaactgtacaaatt
tctactattgctgagagtgatgattctcaggagtcagtggacagtgtgacagattctcag
aaaaggagagagattctgtctagacggccctcatacagaaagatcctgaatgacctttca
tctgatgctccagcggtgccacggatagaagaagagaaatcagaggaggactccactcca
gccataacaaccgttactgtgccaacgcccatctatcagacaagtagcgggcaatacatt
gctatcactcagggtggggcgatccaattagccaataacgggacggatggagtgcaggga
ctgcagacactaaccatgacaaacgccgctggagctcagcccggcaccaccatcctgcag
tatgcacagaccagtgacggccagcagatacttgttcccagcaatcaagtagtggtgcaa
gcggcatcaggagacgttcaggcttatcagatccgcactgcagctgcgagcaccattgct
cctggggtggtcatggcctcttccccagcactgcccagtcagggagctgaggaggccaca
cgtaagcgggaagttcggctgatgaagaacagggaggcagcacgggagtgccgcagaaaa
aagaaagagtatgtgaaatgtctggaaaacagagtggctgtgttggagaatcagaacaaa
acgctcatcgaggagctcaaagcgcttaaggacctttactgtcacaaatctgaataa

DBGET integrated database retrieval system