KEGG   Danio rerio (zebrafish): 573207Help
Entry
573207            CDS       T01004                                 

Gene name
creb1a
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04261  Adrenergic signaling in cardiomyocytes
dre04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    573207 (creb1a)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    573207 (creb1a)
Transcription factors [BR:dre03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    573207 (creb1a)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    573207 (creb1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf DUF4988
Motif
Other DBs
NCBI-GeneID: 573207
NCBI-ProteinID: NP_957203
ZFIN: ZDB-GENE-040426-750
Ensembl: ENSDARG00000053586
Vega: OTTDARG00000029852
UniProt: Q803K8
Position
1
AA seq 318 aa AA seqDB search
MTMEAGADVQQGGDTAVSETDTQQIATLAQVSMAAAQASATAPTVTLVQLPNGQTVQVHG
VIQAAQPSVIQSPQVQTVQISTIAESDDSQESVDSVTDSQKRREILSRRPSYRKILNDLS
SDAPAVPRIEEEKSEEDSTPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQG
LQTLTMTNAAGAQPGTTILQYAQTSDGQQILVPSNQVVVQAASGDVQAYQIRTAAASTIA
PGVVMASSPALPSQGAEEATRKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNK
TLIEELKALKDLYCHKSE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggaggcaggagcagatgtccagcagggcggcgacactgcggtctcagagaca
gacactcagcagattgccaccttggcacaagtttccatggcggcagcacaggcatcagca
actgcacccacagtgaccttagttcagctgcccaatgggcaaacagtgcaagttcacggg
gtcatccaggcagcccagccctctgtcatacaatccccacaggtgcaaactgtacaaatt
tctactattgctgagagtgatgattctcaggagtcagtggacagtgtgacagattctcag
aaaaggagagagattctgtctagacggccctcatacagaaagatcctgaatgacctttca
tctgatgctccagcggtgccacggatagaagaagagaaatcagaggaggactccactcca
gccataacaaccgttactgtgccaacgcccatctatcagacaagtagcgggcaatacatt
gctatcactcagggtggggcgatccaattagccaataacgggacggatggagtgcaggga
ctgcagacactaaccatgacaaacgccgctggagctcagcccggcaccaccatcctgcag
tatgcacagaccagtgacggccagcagatacttgttcccagcaatcaagtagtggtgcaa
gcggcatcaggagacgttcaggcttatcagatccgcactgcagctgcgagcaccattgct
cctggggtggtcatggcctcttccccagcactgcccagtcagggagctgaggaggccaca
cgtaagcgggaagttcggctgatgaagaacagggaggcagcacgggagtgccgcagaaaa
aagaaagagtatgtgaaatgtctggaaaacagagtggctgtgttggagaatcagaacaaa
acgctcatcgaggagctcaaagcgcttaaggacctttactgtcacaaatctgaataa

DBGET integrated database retrieval system