KEGG   Danio rerio (zebrafish): 574009Help
Entry
574009            CDS       T01004                                 

Gene name
alpi.2, si:ch211-262h13.2, wu:fb68b10, zgc:110409
Definition
alkaline phosphatase, intestinal, tandem duplicate 2 (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    574009 (alpi.2)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     574009 (alpi.2)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   574009 (alpi.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
22
AA seq 521 aa AA seqDB search
MAKTQALLLIGIFASAGFDGCFSVVPEEEKNPNFWYVKAKDSLHASLSMTFNTHRAKNLI
LFLGDGMGISTVTAARVLKGQMNKKTGEESVLAMDTFPYLALSKTYNVDQQMPDSAATAT
AYLCGVKANYGTLGLSAAAQREVCSSVKGNEVKSILHQAKMAGKSVGIVSTARVQHASPA
ASYSHTPERGWYSDKELTSEAVAGGCQDIAVQLITNTDINVILGGGRQYMFPRETTDPEY
STVTGSRKDKRNLVDEWLKNRKNAQYVWNKQQFDAVNEDKTDYLMGLFEPKDTRYELERD
PKMDPSLTEMVEKAIKILRKNPNGFYLFVEGGRIDHGHHAGQAKYALTEAVEFDNSIERA
GQLTSELDTLSVVTADHSHVFSFGGYSYRGNPVLGVSYAKGEDGKSFTNALYGNGPGYQI
TNGTRPDVNESVSGRDDYLQQAAVPLDSETHGSEDVAIFAKGPMAHLFHGVQEQSYIPHA
MAFAACIEPYSDCQLHDSGVYTQFSVAVLLFSLMSSITALI
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaacacaagccctgctgctcattggaatattcgcatcagcaggattcgatgga
tgtttctccgttgttcctgaggaggagaagaacccaaacttttggtatgtaaaggctaaa
gattctctacacgcatcgctctcaatgacattcaacacgcaccgcgccaaaaacctcatc
ctcttcctcggagatggcatgggaatcagcaccgtgaccgcagcaagagtcttgaaggga
cagatgaacaagaaaacaggagaagaaagtgtcttagccatggacaccttcccgtacctc
gctttgtccaagacctataatgtggaccagcagatgcctgacagtgcagcgacggccact
gcgtatctctgtggtgtgaaggcaaactacggcactctgggactcagtgcggctgcgcag
agagaagtctgcagctccgttaaaggcaacgaggtcaaatccatccttcatcaggccaag
atggcagggaagtctgtcggtatagtgagcacagcacgtgtccagcacgcgtcgcccgcc
gccagttactcgcacacccctgagcgaggctggtacagcgataaagagctgacgtctgaa
gccgtggcaggaggatgccaagatatcgcagtccagctcatcactaacacggatataaac
gttattttaggtggcggcaggcagtatatgtttcctcgggaaaccactgatcctgaatac
tccacagtcacagggagccggaaagacaaaagaaatcttgttgatgagtggctaaaaaac
agaaaaaatgctcaatatgtgtggaataaacaacagtttgatgctgtaaatgaggacaag
acagattatttaatggggctttttgagccaaaggacaccaggtacgagctggagcgtgat
cctaagatggacccgtcgctgacagaaatggtggaaaaagccataaagattctcaggaaa
aaccccaatgggttctacctctttgtggaaggcgggagaatagatcacggccatcacgcg
ggacaggccaaatacgctctgactgaagctgtggagttcgacaattctatcgagcgggcc
ggacagctgaccagcgaactcgacaccctgtctgtggtcaccgctgaccactcacacgtg
ttttcttttggtggatactcctacaggggcaaccctgtgctgggtgtttcctatgccaaa
ggtgaggatggaaagagttttaccaatgcgctttacggaaacggtccaggataccagatc
actaacgggactcgacctgatgtcaatgagagcgtttcaggccgtgatgactatctccaa
caggctgcggttcctcttgattcagaaactcacggctcggaggatgtggctattttcgct
aaagggccgatggcgcacctcttccacggggtgcaagagcagagctacattcctcacgct
atggccttcgcagcctgcatcgagccgtacagcgactgtcagctacacgactctggtgtc
tacactcagttcagcgtcgccgtgctgctgttcagcctgatgtcctccattactgctctt
atttaa

DBGET integrated database retrieval system