KEGG   Danio rerio (zebrafish): 58118Help
Entry
58118             CDS       T01004                                 

Gene name
bdnf
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    58118 (bdnf)
Cytokines [BR:dre04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    58118 (bdnf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
7
AA seq 270 aa AA seqDB search
MTILFVTMVISYFSCMRAAPMREIPGVQGGHRAEGYLGAAAAAAAAVTSGSRGHGTPQSG
GGLPSLTDTFEQVIEELLEVEGEATQQLGPGADQGQGGGGPIDAADSKDVDLYASRVMIS
NQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISQWVTAVDKKTAI
DMSGQTVTVLEKVPVTNGQLKQYFYETKCNPLGYTKEGCRGIDKRHYNSQCRTTQSYVRA
LTMDSKRKIGWRFIRIDTSCVCTLTIKRGR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcctgttcgttactatggttatttcatacttcagttgcatgagagctgcgccc
atgagagagatcccgggcgtgcaggggggccaccgggccgagggctacctgggcgccgct
gccgctgctgccgctgccgtcacatcgggcagccgaggccacgggactccacagagtggg
ggcgggctgccctcgctcacggacactttcgagcaggtcattgaggagttgcttgaggtg
gaaggggaagcgacgcagcaactggggcctggggccgaccagggccaaggagggggcggc
cctatagatgcggcagactcgaaggacgttgacctgtatgcctcgcgggtgatgatcagc
aaccaagtgcctttggagccgccgttactctttctcttggaggaatacaaaaactacctg
gatgccgccaacatgtcgatgcgtgtgcggcgacactcggaccccgcacggcggggggag
ctcagcgtttgtgacagtattagccagtgggtgacagctgtggacaaaaagacggcaata
gacatgtcgggccagacggtcaccgttctggagaaggtccccgtgactaatggtcagctg
aagcaatacttttacgagaccaaatgcaaccccttggggtacacaaaggagggctgccga
ggaatagacaagcggcactataactcgcaatgccggacaacccagtcttacgtgcgagcc
cttaccatggatagcaaaaggaagatcggctggcggtttatacggatagacacttcgtgt
gtatgcacattgaccattaagaggggcagatag

DBGET integrated database retrieval system