KEGG   Danio rerio (zebrafish): 60640Help
Entry
60640             CDS       T01004                                 

Gene name
cyp19a1b, AroB, CYP19a2, P450aromB, cyp19, cyp19b, zgc:92614
Definition
cytochrome P450, family 19, subfamily A, polypeptide 1b
Orthology
K07434  
aromatase [EC:1.14.14.14]
Organism
dre  Danio rerio (zebrafish)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    60640 (cyp19a1b)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.14  aromatase
     60640 (cyp19a1b)
Cytochrome P450 [BR:dre00199]
 Cytochrome P450, animal type
  CYP19 family
   60640 (cyp19a1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
25
AA seq 511 aa AA seqDB search
MMEHVVKDAVNIGAVVQGTLLLLTGTLMLILLHRIFGVKNWRNQSALPGPGWWLGLGPVL
SYSRFLWMGIGTACNYYNEKYGSIARVWINGEETVILSKSSAVYHVLKSNNYTGRFASAK
GLQCIGMFEQGIIFNSNIAKWKKVRTYFTKALTGPGLQKSVEVCVSATNRQLDVLQEFTD
ASGHVDVLNLLRCIVVDVSNRLFLRIPLNEKELLIKIHRYFSTWQTVLIQPDIFFKLDFV
YRKYHLAAKELQDEMGKLVEQKRQAINNTEKLDEMDFATELIFAQNHDELSVDDVRQCVL
EMVIAAPDTLSISLFFMLLLLKQNSAVEEQIVQEIQSQIGSRDVESADLQKLNVLERFIK
ESLRYHPVVDFIMRQSLEDDYIDGYRVAKGTNLILNIGRMHKTEFFKKPNEFSLENFENT
VPSRYFQPFGCGPRACVGKHIAMVMTKAILVTMLSRFTVCPRHGCTISTIKQTNNLSMQP
VEEDPDCLAMRFIPRAQNSNGETADNRTSKE
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgatggagcatgtggtaaaggatgcggtaaacatcggcgctgtggtgcagggaacgtta
ctgctgctgacgggaaccttaatgctgattctgctgcacagaatttttggtgtcaagaat
tggaggaatcaatcagctcttccaggtcccggttggtggttgggtctggggccggttctg
agttacagtcggttcctctggatgggcatcggcacggcgtgcaactactacaatgagaaa
tacggcagcatcgctcgagtttggatcaatggagaagagactgttatactaagcaagtcc
tccgctgtgtaccatgtcctgaagagcaataattacacagggaggtttgccagtgccaaa
ggtctgcaatgcataggtatgtttgaacaaggcatcatcttcaacagcaacatcgcaaag
tggaagaaagtgagaacatacttcactaaagctcttacaggtccaggtctccagaagtca
gtagaggtgtgtgtgagcgccaccaacagacagcttgacgtcctgcaggagttcacagac
gcctcaggacatgtggatgtgctcaatctcctgcgctgcatcgtggtggacgtctccaac
agactcttcctaagaatccctctcaatgagaaagagttactaataaagatccaccggtat
ttcagtacctggcagacggttctcatacagcccgatattttcttcaaactggactttgtg
tacagaaaataccacctggcagcaaaagagctgcaggatgaaatgggaaagcttgtggag
caaaagcgacaggccatcaataacacagagaagctagatgaaatggacttcgcaacagag
ctgatatttgctcagaaccatgatgagctgtctgtggacgacgtgaggcagtgtgtgctg
gagatggtgatcgctgctccagacacgctctccatcagtctgttcttcatgcttctgctg
ctaaagcaaaactctgctgtggaagagcaaatcgtacaggagatacagtctcagataggc
tcgcgagatgtagagtctgctgacttgcagaaactgaatgttctagagcgcttcatcaaa
gagtccctgaggtaccatccggtggtggatttcatcatgaggcagtctctggaggatgac
tacattgatggctaccgggtggcaaaggggacaaacctaatcctgaacattggacgcatg
cataagacagagttcttcaaaaaacccaacgaattcagcttggagaacttcgagaacact
gttcccagtcgttacttccagccattcggttgtggtccgcgggcctgtgttgggaagcac
attgctatggtgatgacgaaggccatcctagtaaccatgttatcaaggtttacagtttgt
cctcgtcacggctgcaccatcagcaccatcaaacagaccaacaacctctccatgcagcca
gtagaagaggatcccgactgcctggccatgcgcttcatcccgcgagctcaaaacagcaac
ggagaaacagcggacaaccgcacctcaaaggaataa

DBGET integrated database retrieval system