KEGG   Danio rerio (zebrafish): 641488Help
Entry
641488            CDS       T01004                                 

Gene name
ugt1a1, zgc:123097
Definition
UDP glucuronosyltransferase 1 family polypeptide a1 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dre  Danio rerio (zebrafish)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    641488 (ugt1a1)
   00053 Ascorbate and aldarate metabolism
    641488 (ugt1a1)
   00500 Starch and sucrose metabolism
    641488 (ugt1a1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    641488 (ugt1a1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    641488 (ugt1a1)
   00860 Porphyrin and chlorophyll metabolism
    641488 (ugt1a1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    641488 (ugt1a1)
   00982 Drug metabolism - cytochrome P450
    641488 (ugt1a1)
   00983 Drug metabolism - other enzymes
    641488 (ugt1a1)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     641488 (ugt1a1)
Glycosyltransferases [BR:dre01003]
 Others
  Hydrophobic molecule
   641488 (ugt1a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Vega: 
UniProt: 
Position
9
AA seq 525 aa AA seqDB search
MRTLPVPAQGLLALLCLFSFESVQAGKVLVLPVDGSHWLSMKILVEELSNRGHEMVVLVP
ETSILIKKSGKYSTKTYPVSFTHDDLAENLKEIQNSALEKAPKLTDIVVNFRNLLQFLTM
QSKTCEGLLYNEPLMKSLREMGFDAMLTDPFLPCGTIIADSFSIPAVYFLRLIPCRLDEA
AAQCPSPPSFMPRYSSGFTDKMTFPQRLVNTLLTVVEGFLCRSMYESADELASKYLQKET
TYAELLGHGAVWLLRYDFAFEFPRPQMPNMVQIGGINCVKRAPLTKELEEFVNGSGEHGF
VVFTLGSMVSQLPEAKAREFFEAFRQIPQRVLWRYTGPVPENAPKNVKLMKWLPQNDLLG
HPKVRAFVTHGGSHGIYEGICNGVPMVMLPLFGDQGDNAQRLVSRGVAESLTIYDVTSEK
LLVALKKVINDKSYKEKMMKLSAIHRDRPIEPLDLAVFWTEFVMRHKGAEHLRPAAHDLN
WIQYHSLDVIGFLLLILLTVIFVTVKSCMFCFRKCFKKSQKKKKA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagaacactgcctgttcctgctcaggggcttctcgccttgctgtgcttgttctctttt
gagtctgtgcaagctggaaaggtgcttgtcttaccagtggatggcagccattggttgagc
atgaagatcctagtggaagagctgtctaataggggacatgagatggtcgttctggtccct
gaaactagtattctgataaaaaaatctgggaaatacagcaccaagacttatcctgtctcc
ttcacccatgatgatctggctgaaaatttgaaagagatacagaacagtgcattggagaag
gctcccaagttaactgatattgttgtcaatttcaggaatctattgcaattcctaactatg
cagtcgaaaacatgtgaaggactgctgtacaacgagcctctgatgaagagtctaagagaa
atgggatttgatgctatgctcacggatcctttcctgccctgtggcactatcattgctgac
tccttctcgattcctgctgtttacttcttgcgtttgattccttgtcgtcttgatgaagca
gctgctcagtgtccttcacctccttcttttatgcctcgctactccagtggttttacagat
aagatgactttccctcagagactagtaaacacacttttgacagttgttgaaggtttcctt
tgccgcagcatgtatgaatctgcagatgaactggcctctaaatatttgcagaaggaaact
acctacgcagagctgttaggtcatggtgcagtttggcttttaaggtatgactttgccttt
gagttccctagaccgcaaatgcccaatatggtccagataggtggaatcaactgtgtaaag
agggctccactgaccaaggaactggaggagtttgtgaacggctctggagagcacgggttt
gttgtcttcactctgggctccatggtgtcacagctacccgaagccaaagccagagagttc
tttgaggcatttagacagatacctcagagagtgttgtggagatacactggaccagtccca
gaaaatgcaccaaagaatgtcaaattaatgaaatggctgccacagaatgacctcttgggc
catcctaaggttagggcttttgttacacatggtggatcacatggaatctatgaaggaatc
tgtaatggagtgcctatggtgatgcttcctctgtttggagaccaaggggataatgctcag
cgtttggtgtctcgaggagtcgcagaaagcctgactatctatgatgtgacctccgaaaaa
ctgctggttgcattgaagaaagtcatcaatgataaaagctacaaggagaagatgatgaag
ctctctgccattcatagagaccgtccaattgaaccactggacctggctgtgttctggact
gagtttgtcatgagacacaaaggagcagagcatctcagacctgcagcccatgacctgaac
tggattcagtatcactctctggacgtcatcggcttccttcttcttattctattgactgtt
atttttgtgactgtcaaaagctgcatgttctgtttcagaaagtgcttcaagaaatctcag
aagaagaagaaggcataa

  All links  
No link information was found.   
DBGET integrated database retrieval system