KEGG   Danio rerio (zebrafish): 641572Help
Entry
641572            CDS       T01004                                 

Gene name
stambpb, zgc:123247
Definition
(RefSeq) STAM binding protein b (EC:3.1.2.15)
  KO
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    641572 (stambpb)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     641572 (stambpb)
Peptidases [BR:dre01002]
 Metallo Peptidases
  Family M67
   641572 (stambpb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
8
AA seq 418 aa AA seqDB search
MLDHADVSLSPEERVRALTKKGGAVEMNESVPLRRYFRSGMEMIRMAHVYAEEGNTEHAF
VLYNKYITLFIEKLPKHPEYKLSNIPEKKEILRKLKDTAFPQAEQLKKLLLRRYEREHAD
YISKKRVEAEAVERELSRQRELDAERRRVAELQRRQQEQEQFSIFEEMIQQRERHRHPHT
HHTPAAPQTDTPLIPGIQGPPVPFPESPTPPQSPQQPSANHSTPSAPAPPTFDRSLKPSH
LTTLIDGLRQIAVPAELCGKFLRLANNNTIRAVETCGILCGTLNRNAFTVTHVVVPKQCG
GPDYCDTENEEELFLVQDQYNLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESIAIV
CSPKFNQTGYFRLTDYGMEEISTCAQKGFHPHPKDPPLFTGGSHIIITEDTVSMLDLR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgctggatcacgcggacgtgagtttgagcccagaggagcgggttcgagccctcaccaag
aagggtggcgcggtggagatgaatgaaagcgtgccactgcgcaggtatttccgctcgggc
atggagatgatccgcatggcacatgtttacgctgaggagggaaacacagaacacgccttc
gtcctctacaacaaatacatcacgcttttcattgagaaactccccaaacatccagaatat
aagctgtctaatattcctgagaagaaggagatactgaggaagctgaaggacacggctttc
cctcaagcagagcagctgaagaagctcctgctcaggagatatgagagagagcatgcagac
tacatcagcaagaagcgtgtggaggctgaggctgtggagcgcgagctgtcccgtcagcgt
gagctggatgcggagcgtcgacgtgtggcagagctgcagaggagacagcaggagcaggag
cagttcagcatcttcgaggagatgatccagcagcgggagcgccatcgccatccgcacaca
caccacactccagcagctccgcagaccgacacaccgctcatcccgggcatccagggtccg
cccgtgccattcccagaatccccaactccacctcagagcccgcagcagccctcagccaat
cacagcactccatcagcaccggctccgcccactttcgaccgttcgctcaaacccagtcac
ctcactacactgatcgatggtttacggcagatcgctgttcccgcggagctgtgtggcaaa
tttctgcggctggccaataacaacactattagggcagtggagacctgcgggatcctctgt
gggacactaaacaggaacgccttcactgtgacacacgtggtggtcccgaagcagtgtgga
ggtccagattactgtgacacagagaacgaagaggagctgtttctggtgcaggaccagtac
aacctcatcactctgggctggatacacactcacccgacacagacggcgtttctgtccagc
gtggatctgcacacacactgctcctatcagatgatgctgcccgagtccatcgccatcgtc
tgctcgcccaaattcaaccagacgggttacttcagactgacagactacggtatggaggag
atctccacctgcgctcagaaaggctttcaccctcatcccaaagaccctcctctgttcacg
ggcggcagtcacatcatcatcacagaagatacggtgtccatgctggacctgcggtga

DBGET integrated database retrieval system