KEGG   Danio rerio (zebrafish): 641572Help
Entry
641572            CDS       T01004                                 

Gene name
stambpb, zgc:123247
Definition
STAM binding protein b (EC:3.1.2.15)
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:dre04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
8
AA seq 418 aa AA seqDB search
MLDHADVSLSPEERVRALTKKGGAVEMNESVPLRRYFRSGMEMIRMAHVYAEEGNTEHAF
VLYNKYITLFIEKLPKHPEYKLSNIPEKKEILRKLKDTAFPQAEQLKKLLLRRYEREHAD
YISKKRVEAEAVERELSRQRELDAERRRVAELQRRQQEQEQFSIFEEMIQQRERHRHPHT
HHTPAAPQTDTPLIPGIQGPPVPFPESPTPPQSPQQPSANHSTPSAPAPPTFDRSLKPSH
LTTLIDGLRQIAVPAELCGKFLRLANNNTIRAVETCGILCGTLNRNAFTVTHVVVPKQCG
GPDYCDTENEEELFLVQDQYNLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESIAIV
CSPKFNQTGYFRLTDYGMEEISTCAQKGFHPHPKDPPLFTGGSHIIITEDTVSMLDLR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgctggatcacgcggacgtgagtttgagcccagaggagcgggttcgagccctcaccaag
aagggtggcgcggtggagatgaatgaaagcgtgccactgcgcaggtatttccgctcgggc
atggagatgatccgcatggcacatgtttacgctgaggagggaaacacagaacacgccttc
gtcctctacaacaaatacatcacgcttttcattgagaaactccccaaacatccagaatat
aagctgtctaatattcctgagaagaaggagatactgaggaagctgaaggacacggctttc
cctcaagcagagcagctgaagaagctcctgctcaggagatatgagagagagcatgcagac
tacatcagcaagaagcgtgtggaggctgaggctgtggagcgcgagctgtcccgtcagcgt
gagctggatgcggagcgtcgacgtgtggcagagctgcagaggagacagcaggagcaggag
cagttcagcatcttcgaggagatgatccagcagcgggagcgccatcgccatccgcacaca
caccacactccagcagctccgcagaccgacacaccgctcatcccgggcatccagggtccg
cccgtgccattcccagaatccccaactccacctcagagcccgcagcagccctcagccaat
cacagcactccatcagcaccggctccgcccactttcgaccgttcgctcaaacccagtcac
ctcactacactgatcgatggtttacggcagatcgctgttcccgcggagctgtgtggcaaa
tttctgcggctggccaataacaacactattagggcagtggagacctgcgggatcctctgt
gggacactaaacaggaacgccttcactgtgacacacgtggtggtcccgaagcagtgtgga
ggtccagattactgtgacacagagaacgaagaggagctgtttctggtgcaggaccagtac
aacctcatcactctgggctggatacacactcacccgacacagacggcgtttctgtccagc
gtggatctgcacacacactgctcctatcagatgatgctgcccgagtccatcgccatcgtc
tgctcgcccaaattcaaccagacgggttacttcagactgacagactacggtatggaggag
atctccacctgcgctcagaaaggctttcaccctcatcccaaagaccctcctctgttcacg
ggcggcagtcacatcatcatcacagaagatacggtgtccatgctggacctgcggtga

DBGET integrated database retrieval system