KEGG   Danio rerio (zebrafish): 64263Help
Entry
64263             CDS       T01004                                 

Gene name
gch2, fb51g02, gch, gch1b, wu:fb51g02
Definition
GTP cyclohydrolase 2 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dre  Danio rerio (zebrafish)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    64263 (gch2)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     64263 (gch2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
12
AA seq 240 aa AA seqDB search
MEYQKAAELNSLCNGKIVTEYLCRNGFSDLTVDTKKVAVQHKNETSRKEEEDESRLPALE
AAYTTILRGLGENTDRQGLLKTPLRAAKAMQFLTKGYHETIYDILNDAIFDEDHEELVIV
KDIDMFSLCEHHLVPFFGKVHIGYLPSKKVVGLSKLARIVEIYSRRLQVQERLTKQIAMA
ISEALQPVGVAVVIEAAHMCMVMRGVQKMNSRTVTSAMLGVFREDPKAREEFLALAKSAQ
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggaataccaaaaggcagcagaactgaacagtttgtgcaatggcaaaatcgtcacagag
tatctctgccgcaatggctttagcgacctgacggtcgacacgaaaaaagtcgctgtccag
cacaaaaacgagacatcccggaaagaggaggaggatgagtcgcggttacctgctctggag
gcggcatacaccactatactgcgtggactgggggaaaacaccgaccgacagggtctcctc
aaaacccctctccgtgctgccaaagccatgcagtttctgactaagggataccacgagacc
atctacgatatccttaacgatgccatatttgatgaagaccatgaagagctagtcattgtg
aaagacattgacatgttttcactttgtgaacatcatctagtaccattctttggcaaggtt
cacataggatatctgccaagcaaaaaggttgttggcctcagtaagcttgcaaggattgtt
gaaatctacagtcgcagacttcaagttcaagagcgtctaacaaagcaaatagcgatggca
atctctgaagccctgcagcctgttggtgtggcagttgtcattgaagcagctcacatgtgc
atggtcatgcgtggagtgcagaagatgaacagccgtaccgtgaccagtgcgatgctgggt
gtgttcagagaggatccaaaggcccgagaggagttcctggccctggccaaaagcgcgcag
tga

DBGET integrated database retrieval system