KEGG   Danio rerio (zebrafish): 64265Help
Entry
64265             CDS       T01004                                 

Gene name
aox3, etID47878.22, fc18g02, wu:fc18g02, xdh
Definition
aldehyde oxidase 3
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    64265 (aox3)
   00350 Tyrosine metabolism
    64265 (aox3)
   00380 Tryptophan metabolism
    64265 (aox3)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    64265 (aox3)
   00760 Nicotinate and nicotinamide metabolism
    64265 (aox3)
   00830 Retinol metabolism
    64265 (aox3)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    64265 (aox3)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     64265 (aox3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
22
AA seq 1336 aa AA seqDB search
MSSLSVNSELVFYINGKKIVEKNADPEEMLLAYLRRKVGLTGAKYGCGGGGCGACTVMVS
RYDPLQDTVLHWSVNACLQPICSLHGAAVVTVEGIGSTKTKLHPVQERIVKAHGSQCGFC
TPGMVMSMYTLLRNNPHPTIEDIRETLGGNLCRCTGYRPIIDGFKTFCETPVCCQNGGGN
GKCCMENGNSHNESDISGELFIMDNVLPLDPTQDLIFPPELLIMGKKKAERHCFQGEKVR
WISPSDLKDLIKLKAEHSDAPLLVGNTTIGPKMNLNKTVHPLVIYGGSIAELQAIKWRKN
CITVGAGCSLSVLKDVLQQRIEDLGPEKSRVYQALVQTLQCLAGKQIRNMATIGGNILSA
NPKYDLSSILAAAECTLHIASKDGDREICLSEEFFTDFGKTALRPEEILLAIDIPHSKPW
EFVSAFRQAQRREFAFSIVNAGMRVAFRHDSNVVEHLDIFYGGVGCTLVKARHTCKELIG
RKWDEKLLAEGTQLLEEEISVPATVPGGREEYRKALVLSFFFKFYMQVLLELQQREVGVN
DLPLEYLSALKPFKNEVPQGNYSYQLVPETQSSSDPVGRPNVHLAALQQATGEAVYYDDI
PSVKGELFVSMVTSTRAHAKIISIDASVALAMPGVVDFISAKDVPGQNRRLWFNNPEELF
AEEEVICVGQIIGAIVAETREQAKRAAQQVDITYQDMQPVFFTIEEAIEHESFFDPKRKL
ERGNVEEGFAKADQILEGEMYMGGQEHFYMETQGVIAIPTGEASEIELYVASQHAAYTQE
VVGITLGIDSNKITCHVKRLGGGFGGKVMKIASLSAIAATAAIKTGHAVRCVLERGDDML
ITSGRSPFLGRYKIGYMNDGTILAADITYYSNGGCTLDESSFIMEKALLHMDNGYKIPNL
RGRGLVCKTFLPSYTAFRGFGGPQGLTIIESVLHEVAVKCGLPAHQVRDINLYKEEKCFT
HHKQLFSPHDMVRCWNECLEKSNYTQRCQYIEQFNGHNHWKKRGISIVPIKFGIGFSKGF
YNQGAALVNVYKDGSVVISHGGTEMGQGINTKAIQIASRILKVSMSSIHIKETCTGNVPN
AAPSAASFGTDAVGMAVKNGCEKLMRRLEPLIKKHPQYTWQQLVVEAYCQKISLSATGFF
MGPHTSVDWEKSEGNAYYYFTFGACCSEVEIDCLTGDHKNIRTDIVMDVGRSINPALDVG
QVEGGFVQGIGLYTIEELQFSPQGVLLTRGPSQYKIPALCDVPPQINVHLLRNADNPHAI
YSSKGIGEPPVFFGCTLFFAIKEAIAAARKERGLSESFSFSSPATAEKIRMACEDCFTRM
IPQDKKVKTKPWAINV
NT seq 4011 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctctatctgtgaacagtgaacttgtcttctacatcaatggcaaaaagatcgtg
gagaagaatgctgatccagaagagatgttactggcttacctcagaaggaaagtcggtcta
acgggcgcaaaatatggctgtggtggaggggggtgtggagcctgcactgtgatggtgtcc
agatatgaccctctccaggacaccgtgcttcactggtcggtgaatgcctgtcttcagccg
atttgttctctgcatggtgcggcagtggtgaccgtagagggcatcggaagcaccaagaca
aaactacatccagttcaggagcgtatagtaaaggctcatgggtctcagtgtggcttctgt
actcctgggatggtgatgtccatgtatacattactgagaaacaacccacatcccaccatt
gaggacattcgagagacactgggagggaacctgtgtcgttgtacgggatatcgaccaata
atcgatggatttaaaacattttgtgaaactccagtttgctgccaaaatggtggtggcaat
ggaaaatgttgcatggaaaacggcaactctcacaacgaatctgatatatctggagaactt
ttcatcatggataatgtcttacccctggacccaactcaagatctgatctttccaccagag
ttactgattatgggaaagaaaaaagcagaacgacattgtttccagggtgaaaaggtcagg
tggatttcaccatcagatctaaaagatttaatcaagctgaaagctgaacactctgacgca
cctctgttggttggaaacacaaccatagggccaaagatgaatctgaacaaaactgtccat
ccattggtgatctatggtggaagcattgcagaacttcaagctatcaaatggagaaaaaat
tgcataactgtaggggcaggatgcagtttgtctgttttgaaggatgttcttcagcaaaga
attgaggatcttggaccagagaagagcagggtttaccaggctctcgttcagacactgcag
tgtttggccggcaaacagattcgtaacatggctaccattggtggaaatatcctgagtgcc
aaccccaagtatgacctgagcagcattttagcagcagctgagtgtacgctacacattgct
tcaaaagatggtgatcgagagatttgtctaagtgaggagtttttcacagactttggaaaa
acagctctacgacctgaggagattctgctggctattgacattcctcattcaaagccgtgg
gagtttgtgtccgcatttcgccaggcacagcgcagagagttcgctttctccatagtgaat
gctggtatgagagtggcattcagacatgattcaaatgtggtggagcatctggatattttt
tatggaggcgtgggttgcactctggtaaaagccagacacacctgtaaggaactgattgga
agaaaatgggatgagaaacttctggcagagggaacacagctcttagaagaagaaatctcg
gtacccgctactgtccctggtggacgggaagaatatcgcaaagctctagtgctcagtttc
tttttcaagttttacatgcaagtgttgctggagcttcaacaaagggaggttggcgtgaat
gatctcccattagagtatctcagcgcattaaaacccttcaaaaatgaagtgccgcaagga
aattactcttaccaacttgtaccagagactcagtcctctagtgacccagtaggacgtccc
aacgtacacctggcagcgctccagcaggctacaggagaagctgtgtattatgatgacatc
ccatctgttaaaggagaactgtttgtttccatggtaaccagcacccgggctcatgcaaag
atcatctctatagatgcatcagtggctctagctatgcctggagtggttgacttcatctct
gctaaggatgttcctgggcagaatcgaagactctggttcaacaatcctgaggaacttttt
gcagaagaggaggtcatttgtgtggggcagattattggtgcgattgtagctgagactaga
gaacaagctaaacgagcagctcagcaagtagacattacttaccaggatatgcaacctgtc
tttttcacaattgaggaggctattgaacacgagtcattttttgaccccaagagaaagctg
gaaagaggaaatgtggaagaaggttttgcaaaggcagaccaaattctagagggtgagatg
tatatgggtggccaggaacacttctacatggaaactcagggagtgattgcaattcctaca
ggagaagcaagtgaaattgagctatatgttgccagtcagcatgcagcttacactcaggaa
gtggtgggaatcactctcggcattgactccaacaagatcacgtgtcatgtaaagaggctg
ggaggtggttttggtggtaaagtcatgaagattgcatcattatctgctatcgctgctacg
gctgccataaagactggccatgctgtgcgatgtgtactagaacgtggagatgacatgctc
atcaccagtggaagatctcctttcttggggaggtacaagattggctatatgaatgacgga
acaatcctggctgctgatatcacatactacagtaatggaggatgcactcttgatgaatcc
tcttttattatggagaaagctcttcttcacatggataatggctacaagatccctaatcta
cgtggacgtggactggtgtgcaagaccttcttaccttcatacacagccttccgtggattt
ggtggacctcaagggttgaccattattgagagtgtgctacatgaggtggcggtcaagtgt
ggcctacctgcacatcaggtaagagacatcaatttgtacaaggaggagaaatgctttacc
caccacaagcagctgttttcccctcatgatatggtgcgctgctggaacgagtgtctagag
aagtccaactacacccaacgatgccagtacatcgagcagtttaacggccacaaccattgg
aagaagcgagggatttccattgtccctataaagtttggaatcggattctcgaagggcttc
tataaccagggagcagcattggtgaacgtctacaaagatggatcagttgtgatttctcat
ggaggaactgagatgggtcaaggtatcaacaccaaagccatacagattgcaagccgcatt
ctgaaggtttcaatgtcctcgatccacatcaaagagacttgtactggaaatgtgcccaat
gctgcaccatccgcggcatctttcggcacagatgctgttgggatggcggtcaagaatggt
tgtgagaaactaatgagacgtctagagccactcattaagaaacatccccaatacacatgg
caacaactggtggtggaagcttactgccagaagattagtttgtcagcaactggtttcttt
atgggcccccacaccagcgttgactgggagaagagtgagggcaatgcgtactattacttt
acttttggggcctgttgctcagaggtggaaattgattgcttgacaggagatcacaagaac
attaggactgacattgtgatggatgttggtcggagcataaatcctgctttggacgtcgga
caggttgagggtggttttgtccagggcattggactctatactatagaggagttgcagttt
tctccgcagggtgttttgttgaccagaggaccctcgcagtacaaaattccagctctgtgt
gacgtccctcctcaaattaatgtccatctcctgagaaatgctgacaatcctcatgccatc
tactcctcaaagggcattggagaacccccagtattttttggctgtactttattcttcgcc
attaaagaagcgattgccgccgcacggaaagagagaggcctgagcgaaagtttctctttc
tcttctcctgccactgcagagaagatacgcatggcctgtgaagactgcttcaccagaatg
attccacaagacaagaaagtaaaaaccaaaccgtgggccatcaacgtgtga

DBGET integrated database retrieval system