KEGG   Danio rerio (zebrafish): 65226Help
Entry
65226             CDS       T01004                                 

Gene name
rpa2, ik:tdsubc_2g1, rpa, xx:tdsubc_2g1, zgc:109822
Definition
replication protein A2
Orthology
K10739  
replication factor A2
Organism
dre  Danio rerio (zebrafish)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    65226 (rpa2)
   03420 Nucleotide excision repair
    65226 (rpa2)
   03430 Mismatch repair
    65226 (rpa2)
   03440 Homologous recombination
    65226 (rpa2)
   03460 Fanconi anemia pathway
    65226 (rpa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
16
AA seq 272 aa AA seqDB search
MWNQGKYGEASMAGYTQSPGGFGSPAASQGGDKKGRTRAQQIVPCTVSQLLSAVQAEDVF
KVGEVEIAQVTIVGVIRSTDKSTINIQYKVDDMTAAPMDVKQWIDTEDMGVDNSVIPPGS
YVKVSGNLRSFQNNRSLVAFSVRVLEDMNEVTSHMLEVVNAHLQQSKPQNMGGDERMMPV
SHNSMNSMGTTGGYSGANMMLVNGLSATQNQVLSLIKSCQELQGISMHELKQKLNSMSAN
VIRQTVDFLSNEGHQYVHQSEKDPFRSTDNEA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaccaaggtaaatacggagaggccagtatggctgggtacacacagtctcctgga
ggattcgggtcaccagccgcttctcaaggaggagacaaaaaggggaggacacgagcgcag
cagatcgttccctgtactgtatctcagctgttgtcggcggtgcaggctgaggacgtcttt
aaagtgggagaggtggagatcgcacaggtgaccattgttggtgtgatccgaagcacagat
aaatccacaatcaacatccagtacaaggtggatgacatgactgcagcccctatggatgtc
aagcagtggattgacacagaggacatgggtgtggataactcggtcattcctcccggctct
tacgtcaaagtctctggcaaccttcgctcttttcagaataacaggtctttggtggcgttc
agcgttcgagtgctggaggacatgaatgaagtgacatcgcacatgctggaggttgtgaac
gctcatctccagcagagcaaaccacagaacatgggaggtgatgagagaatgatgccagtg
tctcataacagcatgaatagtatgggcaccacaggaggctattctggtgctaacatgatg
ctagtcaatggcttgagtgccacacagaaccaagttttgagtctgatcaagagctgtcaa
gagcttcagggaatcagcatgcatgaactcaagcagaagctcaacagcatgagcgccaac
gtcatcaggcaaactgtggactttctcagcaacgagggccaccaatatgtccaccaatcg
gagaaagatcctttccggtcaacagacaatgaagcctaa

DBGET integrated database retrieval system