KEGG   Danio rerio (zebrafish): 65226Help
Entry
65226             CDS       T01004                                 

Gene name
rpa2
Definition
(RefSeq) replication protein A 32 kDa subunit
  KO
K10739  
replication factor A2
Organism
dre  Danio rerio (zebrafish)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    65226 (rpa2)
   03420 Nucleotide excision repair
    65226 (rpa2)
   03430 Mismatch repair
    65226 (rpa2)
   03440 Homologous recombination
    65226 (rpa2)
   03460 Fanconi anemia pathway
    65226 (rpa2)
DNA replication proteins [BR:dre03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    65226 (rpa2)
DNA repair and recombination proteins [BR:dre03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     65226 (rpa2)
   MMR (mismatch exicision repair)
     65226 (rpa2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     65226 (rpa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
16
AA seq 271 aa AA seqDB search
MWNQGKYGEASMAGYTQSPGGFGSPAASQGGDKKGRTRAQQIVPCTVSQLLSAVQAEDVF
KVGEVEIAQVTIVGVIRSTDKSTINIQYKVDDMTAAPMDVKQWIDTEDMGVDNSVIPPGS
YVKVSGNLRSFQNNRSLVAFSVRVLEDMNEVTSHMLEVVNAHLQQSKPQNMGGGGGMMPV
SHTSMNSMGTTGGYSGANMMLVNGLSANQNQVLSLIKSCQEPQGISMHELKQKLNSMSAN
VIRQTVDFLSNEGHIFSTIDEDHFRSTDNEA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaccaaggtaaatacggagaggccagtatggctgggtacacacagtctcctgga
ggattcgggtcaccagccgcttctcaaggaggagacaaaaaggggaggacacgagcgcag
cagatcgttccctgtactgtatctcagctgttgtcggcggtgcaggctgaggacgtcttt
aaagtgggagaggtggagatcgcacaggtgaccattgttggtgtgatccgaagcacggat
aaatccacaatcaacatccagtacaaggtggatgacatgactgcagcccctatggatgtc
aagcagtggattgacacagaggacatgggtgtggataactcggtcattcctcccggctct
tacgtcaaagtctctggcaaccttcgctcttttcagaataacaggtctttggtggcgttc
agcgttcgagtgctggaggacatgaatgaagtgacatcgcacatgctggaggttgtgaac
gctcatctccagcagagcaaaccacagaacatgggaggtggtggagggatgatgccagtg
tctcataccagcatgaatagtatgggcaccacaggaggctattctggtgctaacatgatg
ctagtcaatggcttgagtgccaaccagaaccaagttttgagtctgatcaagagctgtcaa
gagcctcagggaatcagcatgcatgaactcaagcagaagctcaacagcatgagcgccaac
gtcatcaggcaaactgtggactttctcagcaacgagggccacattttctccaccatcgac
gaagatcacttccggtcaacagacaatgaagcctaa

DBGET integrated database retrieval system