KEGG   Danio rerio (zebrafish): 65236Help
Entry
65236             CDS       T01004                                 

Gene name
mapk8b
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04012  ErbB signaling pathway
dre04068  FoxO signaling pathway
dre04137  Mitophagy - animal
dre04140  Autophagy - animal
dre04141  Protein processing in endoplasmic reticulum
dre04210  Apoptosis
dre04217  Necroptosis
dre04310  Wnt signaling pathway
dre04510  Focal adhesion
dre04530  Tight junction
dre04620  Toll-like receptor signaling pathway
dre04621  NOD-like receptor signaling pathway
dre04622  RIG-I-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04920  Adipocytokine signaling pathway
dre04933  AGE-RAGE signaling pathway in diabetic complications
dre05132  Salmonella infection
dre05168  Herpes simplex infection
Module
dre_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    65236 (mapk8b)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    65236 (mapk8b)
   04012 ErbB signaling pathway
    65236 (mapk8b)
   04310 Wnt signaling pathway
    65236 (mapk8b)
   04068 FoxO signaling pathway
    65236 (mapk8b)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    65236 (mapk8b)
   04137 Mitophagy - animal
    65236 (mapk8b)
  Cell growth and death
   04210 Apoptosis
    65236 (mapk8b)
   04217 Necroptosis
    65236 (mapk8b)
  Cellular community - eukaryotes
   04510 Focal adhesion
    65236 (mapk8b)
   04530 Tight junction
    65236 (mapk8b)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    65236 (mapk8b)
   04621 NOD-like receptor signaling pathway
    65236 (mapk8b)
   04622 RIG-I-like receptor signaling pathway
    65236 (mapk8b)
   04625 C-type lectin receptor signaling pathway
    65236 (mapk8b)
  Endocrine system
   04910 Insulin signaling pathway
    65236 (mapk8b)
   04920 Adipocytokine signaling pathway
    65236 (mapk8b)
   04912 GnRH signaling pathway
    65236 (mapk8b)
   04914 Progesterone-mediated oocyte maturation
    65236 (mapk8b)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    65236 (mapk8b)
  Infectious diseases
   05132 Salmonella infection
    65236 (mapk8b)
   05168 Herpes simplex infection
    65236 (mapk8b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     65236 (mapk8b)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   65236 (mapk8b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH RIO1 Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 65236
NCBI-ProteinID: NP_571796
ZFIN: ZDB-GENE-010202-1
Ensembl: ENSDARG00000009870
Vega: OTTDARG00000020657
UniProt: Q9DGD9
Position
12
AA seq 384 aa AA seqDB search
MNRNKREKEYYSIDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDHVLDRNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSIGCIMAEMVRGSVLFPGTDHIDQWNKVIEQ
LGTPSQEFMMKLNQSVRTYVENRPRYAGYSFEKLFPDVLFPADSDHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEVEAPPPAITDKQLDEREHSVEEWKELIYKEV
LEWEERTKNGVIRGQPASLAQVQQ
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggaataagcgcgagaaagaatattacagcatagatgtaggagattcaacgttc
accgttttgaagcgctatcagaatttaagaccaatcgggtccggagcacaaggcatcgtc
tgctcagcgtatgaccacgtcctcgatcgaaatgtggcaattaagaaactcagccgaccc
tttcaaaaccaaactcatgccaaacgggcctacagagaactggtcctgatgaaatgcgtc
aaccacaaaaatataattggcttactaaacgtgttcacaccacagaagacacttgaagag
ttccaggatgtttatctggtgatggagctgatggatgcaaacctgtgtcaggtgattcag
atggagctggaccacgagaggctgtcctacctgctctatcagatgctctgcggcattaaa
cacctgcacgctgctggcatcatacacagggatctgaaacccagtaatatagtagtgaaa
tcggactgcacgctgaagatcctggatttcggtctggcccgaacggctgcaaccggcctc
ctcatgactccttatgtcgtgacacgctattatcgggccccagaggtcatcctgggcatg
ggttatcaagctaacgttgatgtctggtctattggctgcatcatggctgaaatggtcaga
ggtagtgtgttgtttcctggcacagaccatattgaccagtggaataaagtgatcgagcag
ctgggcacgccgtcacaggagttcatgatgaagctgaatcagtctgtgaggacgtatgtg
gagaaccggcctcggtatgcgggatacagctttgagaagctcttcccagacgtgctcttc
cccgcagactcggaccacaacaaactcaaggcgagtcaggcacgagacttgttatccaaa
atgctggtaatagatgcatccaagcggatctctgtagacgaggcgcttcagcacccctac
atcaacgtttggtacgacccatcagaagtggaggcgccgccaccagcgatcacggataaa
cagctcgatgagagagaacactcagtggaagagtggaaagagctcatatacaaggaagtg
ctggaatgggaggagcgaacaaaaaatggagtgatcagaggacagccggcctcgctagca
caggtgcagcagtga

DBGET integrated database retrieval system