KEGG   Danio rerio (zebrafish): 65239Help
Entry
65239             CDS       T01004                                 

Gene name
map2k6, MKK3, map2k3, zMKK3
Definition
mitogen-activated protein kinase kinase 6 (EC:2.7.12.2)
Orthology
K04433  
mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Toll-like receptor signaling pathway
GnRH signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:dre04010]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:dre04620]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:dre04912]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
12
AA seq 363 aa AA seqDB search
MEGGSDKESKVFCDSPSPNPKGEMSVPSNVNVRGKKKLPKELKLPKEVFEKPAPAPTPPR
DLDSKAYVTIGEKNFVVKADDLEQIGELGRGAYGVVDKMRHVPSGVIMAVKRIRATVNTQ
EQKRLLMDLDISMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYKQVHEKGKTIP
EDILGKITVSIVKALEHLHSNLSVIHRDVKPSNVLINMQGQVKMCDFGISGYLVDSVAKT
MDAGCKPYMAPERINPETNQKGYNVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVV
EEPSPQLPADRFSADFVDFTSQCLRKNSTERPTYTELMQHPFFTLHDSKDTDVASFVKTI
LGD
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaaggagggagcgacaaggaaagcaaagtcttttgtgattccccttcccccaaccct
aaaggggagatgtccgtgccaagtaacgttaacgtcagaggtaaaaagaagcttccaaaa
gagctcaagcttccaaaagaggtgttcgagaaaccggcacctgctcctacacccccgaga
gacctggactccaaagcctacgttaccattggagaaaagaactttgtggtgaaggccgat
gatttggagcagattggagagttgggacgaggggcgtatggagtggtggacaagatgaga
cacgtccccagcggtgtaataatggcagtaaagcggatccgggccacagtaaacacacag
gagcagaagcggctgctaatggatctggacatctcgatgagaacagtggactgcttttac
accgtcaccttctacggggccttgttcagagagggcgacgtgtggatatgcatggagttg
atggacacttctctggataagttttataagcaggtgcatgagaagggaaagaccatcccg
gaggacatcctgggcaagatcacagtctctattgtgaaagcattagagcatctccacagc
aatctgtcagtcatacacagagacgtcaaaccatctaatgtcctgataaacatgcagggt
caggtgaaaatgtgtgattttggtatcagtgggtatcttgtggattcagtggcaaagacg
atggacgccggctgcaaaccatatatggcgcctgagagaatcaacccagagaccaatcag
aaaggctacaatgtcaaatccgatatctggagtttaggtattacaatgatcgagctggcg
attctgcggtttccctatgactcatgggggacgccatttcagcagctaaagcaggtggtg
gaggagccatcgcctcagctgcccgccgaccgattctctgccgacttcgtggacttcaca
tcacagtgcttaaggaagaattccacagagcgaccgacttatacagaattaatgcaacat
cccttcttcactctccacgactccaaagacaccgacgtggcaagttttgtgaagaccatc
ctcggggactga

DBGET integrated database retrieval system