KEGG   Danio rerio (zebrafish): 664750Help
Entry
664750            CDS       T01004                                 

Gene name
ppox
Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00860  Porphyrin and chlorophyll metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    664750 (ppox)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     664750 (ppox)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     664750 (ppox)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_2 NAD_binding_9 DAO Thi4 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 664750
NCBI-ProteinID: NP_001035068
ZFIN: ZDB-GENE-051120-90
Ensembl: ENSDARG00000102167
UniProt: Q32LU4
Position
16
AA seq 477 aa AA seqDB search
MQKVVAVLGGGIGGLSACHHLSKSPNVSKIVLLEGSGRCGGWLSSVRRDDGAVFEQGPRG
VRPGGAVGRNTLNMVSELGLESELLPITSDHLASQNRFLYVKGQLHKMPSGLGGVLRTIP
PFSRPIIQSVLKELVISKGTEEDESVHAFVSRRLGSELADIAIDCLCRGVFAGDSRQLSV
RSCFPPLYEAEQARGSIVLGMLMGSGAGPKVVPSGLAKRASKESWTQWSLKRGMQTLPEA
LEDSLRRRNGVELHHHAKVKRLNVDSTGWEIKLDDGTSLKADHVISTLPASALASVLPPA
AQTLSEQLRSIASVNVALVNLEYEGFILPVTGFGHLVPSTEDAGVLGVVYDSVPFPEHNR
SRGATTRLTVMMGGAWFEQTFGSPDLVMEQTLLDRAVQAVNSHLSVTSQPVWSCVALLKN
CIPQYHLGHWKRLEKMRQYISNHNLALTLAGASYDGVSVNDVIFSGRTAAEGLVGKI
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggttgtagcagtgcttggtggggggattggtggtctgtcagcctgtcaccac
ctcagcaagagccctaatgtttccaagattgtgctgctggaggggtctgggcgatgtgga
ggttggctgagctccgtacggagggatgacggggctgtatttgagcaaggaccacgaggg
gtgcgacctggaggtgctgtcggacgaaacactctcaatatggtctcagagttgggtctt
gagtccgaactcttgccaattacgagtgatcatttggcatctcagaaccgcttcttgtat
gttaaaggacagctgcacaagatgccttcaggacttggtggggttctccgcaccatccct
cctttctcccgtcctataatccagagtgttttgaaggagttagtaatcagtaaagggaca
gaagaggacgaatctgtgcatgcatttgtgtccagacggctgggctctgagctggcagat
atagccatagactgcctgtgtagaggagtgtttgctggagacagcagacagttgagtgtg
cgctcctgctttcctcctctttatgaagcggagcaggcacgcgggtccatcgtgctgggc
atgctgatgggttcaggtgctggtcctaaagtagtcccttcaggcttggcaaagagagca
tctaaagagtcctggactcagtggtctctaaagaggggcatgcagacccttccagaagcc
ttggaggattcgctgaggaggcgaaatggagtggagcttcaccatcatgccaaagtgaaa
cgtctaaacgtggacagcacaggctgggagattaaactagatgatggcacctctttaaaa
gctgatcatgtgatttctactttacctgcatcagctttggcctcagtgctgcctcctgct
gctcaaaccctgtcagagcagctgcggtccatcgcttcagtgaacgtggctctggtcaat
ctggaatatgaaggcttcatcctcccagttactggctttgggcatttggtgccttctaca
gaagatgcgggagtattaggggtggtgtacgactcagttccttttccagaacacaatcgc
agtagaggagcgacaactagactgacggtgatgatgggaggagcgtggttcgagcagacg
tttgggagtccggatttagtaatggagcagacactgttggatcgagccgttcaagctgtg
aactctcacctgagcgtaacctcacagcctgtttggagctgcgttgctttactaaagaac
tgcattccacagtatcatttaggacactggaaacgacttgaaaagatgaggcaatatatc
agcaaccacaatctggcccttacactggcgggagcttcctacgacggtgtctctgtcaat
gatgttatatttagtgggcggacggcagctgagggtcttgtcggaaaaatatga

DBGET integrated database retrieval system