KEGG   Danio rerio (zebrafish): 677744Help
Entry
677744            CDS       T01004                                 

Gene name
lyz, lys-C, zgc:136734
Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     677744 (lyz)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
24
AA seq 151 aa AA seqDB search
MRLAVVFLCLAWMSSCESKTLGRCDVYKIFKNEGLDGFEGFSIGNYVCTAYWESRFKTHR
VRSADTGKDYGIFQINSFKWCDDGTPGGKNLCKVACSDLLNDDLKASVGCAKLIVKMDGL
KSWETWDSYCNGRKMSRWVKGCEQRKQSLRA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggcagtggtgtttttgtgtctggcgtggatgtcctcgtgtgaaagcaagaca
ctgggacgctgtgatgtttacaagatcttcaagaatgaagggcttgatggatttgaggga
ttctccattggcaactatgtgtgcacggcctactgggaaagcaggtttaagacccaccga
gtgcgttcagctgatacggggaaggactacgggatcttccagattaacagcttcaagtgg
tgtgatgacgggacccctggggggaagaatttgtgcaaagtggcctgttcagacttgctt
aacgatgacctgaaagcttcagttgggtgtgcaaagctgattgtgaaaatggacgggctg
aaatcatgggaaacctgggattcttactgtaacggtcgtaagatgtcccgctgggtaaaa
ggctgtgagcagcgcaaacaaagcctccgagcctga

DBGET integrated database retrieval system