KEGG   Danio rerio (zebrafish): 692275Help
Entry
692275            CDS       T01004                                 

Gene name
usp22, zgc:136342
Definition
ubiquitin specific peptidase 22 (EC:3.4.19.12)
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     692275 (usp22)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   692275 (usp22)
Transcription machinery [BR:dre03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     692275 (usp22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
12
AA seq 417 aa AA seqDB search
MSPAGCSHVNGFKVDNWKQNLRVIYQCFVWSGSAETRKRKAKSCICHMCGAHLNRLHSCL
HCVFFGCFSKKHIHEHAKNKRHNLAIDLLHGGIYCFVCQDYIYDKDMEQIAKEEQRKAWK
LQGIGEKYSMWEPTKRELELLRHNPKRRKITANCTIGLRGLINLGNTCFMNCIVQALTHT
PLLRDFFLSDRHKCEMQSNSCLVCEMSQLFQEFYSGHRSPHIPFRLLHLVWTHARHLAGY
EQQDAHEFLIAALDVLHRHCKGDDNGKKANNPNHCNCIIDQIFTGGLQSDVTCQVCHGVS
TTIDPFWDISLDLPGSSTPFWPLSPGSDGSVVNGDSHPSGATTLTDCLRRFTRPEHLGSS
AKIKCSGCHSYQESTKQLTMKRLPIVACFHLKVRAELLLSVLIFQHPLNVFVCFSAV
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggccgggtgctcccatgtgaacggcttcaaagtggacaactggaagcagaat
ctgcgggtcatctaccagtgctttgtgtggagcggatctgccgaaaccaggaaacgcaag
gcgaagtcatgtatatgtcacatgtgtggagctcatctaaatcggctgcactcgtgtctt
cactgtgtgttcttcggctgtttcagcaagaaacacatccacgaacacgccaaaaacaag
agacacaacctagctatagaccttttgcatggtggaatatattgctttgtgtgccaagac
tacatatacgacaaagacatggagcagattgccaaagaagaacaaagaaaagcgtggaaa
ttgcaaggtattggagagaaatattcaatgtgggaaccaacgaaacgagagctggagctg
ctgcgacacaatcccaaacggaggaaaatcacagccaactgcaccataggactgcgtggt
ttgataaacctgggcaacacgtgctttatgaactgcatcgttcaggctctcacacacact
ccgctgctgagggacttctttctgtccgacagacacaagtgtgagatgcagtccaactcc
tgcctcgtgtgtgagatgtctcaactctttcaggagttttactcgggtcaccgctctccg
cacattcccttccggctgctacatctagtgtggactcacgcccgacacctggccggatac
gagcagcaggacgcgcacgagttcctcatcgccgcgctcgacgtgctgcacagacactgc
aaaggagatgacaatggaaaaaaagccaacaacccaaaccactgcaactgcatcattgac
caaatcttcactggaggcctgcagtctgacgtcacctgccaagtctgccacggcgtctcc
accacgatagacccattctgggacatcagcctggacctgccgggctcctccaccccgttc
tggccgctcagtcccggcagtgatggcagtgtggtgaacggagacagccacccgagcgga
gccaccacgctcacagactgcctgcgcaggttcaccagacccgaacacttaggaagcagc
gccaagataaaatgcagcggttgccatagttaccaggagtccaccaaacagctgacgatg
aagaggcttcctatagtggcctgctttcacctcaaagtaagagcagagctgcttctctct
gtcttgatctttcagcaccccttaaatgtgtttgtgtgtttttcagcggtttga

DBGET integrated database retrieval system