KEGG   Danio rerio (zebrafish): 751641Help
Entry
751641            CDS       T01004                                 

Gene name
cyb5r2
Definition
(RefSeq) NADH-cytochrome b5 reductase 2
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    751641 (cyb5r2)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     751641 (cyb5r2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 751641
NCBI-ProteinID: NP_001038825
ZFIN: ZDB-GENE-060825-83
Ensembl: ENSDARG00000051925
Vega: OTTDARG00000020001
UniProt: Q0P487
Position
25
AA seq 309 aa AA seqDB search
MDILTAPVLIGVSIVVITVLYLFLKPAGSNSTPPKPQNKIPKALQDPSVKYPLPLIEKEE
INHDTKRFRFGLPSSSHVLGLPIGQHIYLSAKVNGSLVVRAYTPVSSDQDQGYVDLVVKV
YYKNTHPSYPDGGKMSQYLDNMKIGDTIDFRGPNGLLVYNGKGKFAIRPDKKSEAEVRKF
KHVAMIAGGTGITPMLQLVRSITADSSDETVCSLIFANQTEKDILLRNELDEVHRNHPSK
LKLWYTLDRPSEGWKYSEGFVNAAMMKDHLPPADSDVLVVMCGPPAMIEKACLPNLLKLG
YKKENIFAY
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggacattctaacagcacctgtgctcatcggggtctctatagtggtgatcaccgtcctc
tacctcttcctcaaaccagcaggctccaacagcacgcctccaaaaccccaaaacaagatt
ccaaaagccttgcaggaccccagtgtgaaatacccattgccactcatagaaaaagaggaa
atcaatcatgacacaaaaagattcaggtttggtcttccgtcctcatctcatgttcttgga
ctcccaatcggtcagcatatttatttgtctgcaaaagtgaatgggagtctggtggtacgt
gcttacactcctgtgtccagcgatcaagatcagggttatgttgatctagttgtaaaggtt
tactataaaaatactcatccaagctatcctgatggaggcaagatgtctcagtacttggat
aatatgaagattggagacactattgactttagaggtccaaatggattattggtgtacaat
ggaaaggggaagtttgctattcgacctgacaaaaaatctgaagctgaagtgcggaagttt
aaacacgtggccatgattgctggcggcacaggcatcactccaatgctgcagctggtcagg
agcatcaccgcagactcatctgacgagaccgtgtgctctctcatattcgccaatcagact
gagaaggacatacttttacgtaacgagctggatgaagtccacaggaatcacccatctaaa
ctcaaactctggtacactctggacagaccctctgaaggctggaagtacagtgaagggttt
gttaacgcagccatgatgaaagatcatctgccgcctgcagacagtgatgtgctggtggtc
atgtgcggacctccagccatgatcgagaaagcctgcctgcccaatctgctcaagctgggc
tacaaaaaagaaaacattttcgcatactga

DBGET integrated database retrieval system