KEGG   Danio rerio (zebrafish): 751668Help
Entry
751668            CDS       T01004                                 

Gene name
gck, fb57f10, glk, hex4, wu:fb57f10, zgc:153643
Definition
glucokinase (hexokinase 4, maturity onset diabetes of the young 2) (EC:2.7.1.2)
Orthology
K12407  
glucokinase [EC:2.7.1.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:dre01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dre00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dre00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dre00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dre00520]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis [PATH:dre00524]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:dre04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Position
8
AA seq 476 aa AA seqDB search
MPCLTSARRQRIPSDFESVLEKILMVDQILSEFVLSKEELEEVMRRMRREMERGLRVETH
DEASVKMLPTYVRSTPEGSEVGDFLALDLGGTNFRVMLVKVGEDEERGWKVETKHHMYSI
PEDAMTGTAEMLFDYIAGCISDFLDKHNLKHKKLPLGFTFSFPVRHEDLDKGILLNWTKG
FKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRSCEVGMIVGTGC
NACYMEEMRKVELVEGEEGRMCVNTEWGAFGDHSELEDFRLEYDRVIDETSLNPGHQLYE
KLIGGKYMGELVRLVLLKLVNEDLLFNGEASDLLKTRGAFETRFVSQIESDTGDRKQIYN
ILSCLGILPSELDCDIVRLACESVSTRAAHLCGAGLAGVINLMRERRCQEELKITVGVDG
SVYKLHPHFKERFHKLVWELTPHCEITFIQSEEGSGRGAALISAVACKMAACMLTP
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgtcttacttcagcccgtagacagaggataccgagcgactttgagtcagtgctg
gagaaaatcctcatggtggaccaaattctgtctgagtttgtgttgagtaaagaagagctg
gaggaggtgatgaggcgaatgcggagagagatggagagaggactgcgtgtggagacacat
gatgaagccagtgtcaaaatgttgcccacgtatgtccggtccacacctgaaggctccgag
gttggtgatttcctggcactggatcttggagggacaaattttcgagtgatgcttgtgaaa
gtgggtgaggatgaagagcgaggctggaaggtggaaaccaaacatcacatgtactccatc
cctgaagatgccatgaccggcacagctgaaatgttgtttgattacattgccggctgcata
tctgacttcctggacaaacataatctcaaacacaagaagctaccactgggattcaccttc
tcttttccagtgcgtcacgaggatttggacaaggggattcttctgaactggactaaaggc
ttcaaggcctctggcgctgagggcaataatgttgtgggtcttctgagagacgccatcaaa
agaagaggggactttgaaatggatgtggtggccatggtgaacgacacagtagccaccatg
atctcctgctactatgaagaccgcagctgtgaagtcggcatgatagtaggtacaggctgc
aatgcgtgttatatggaggagatgcgtaaggtggagctggttgaaggagaggagggccgg
atgtgtgtgaacacagaatggggggcatttggggaccacagtgaactggaggacttcagg
ctggaatacgaccgtgttattgatgagacgtcactcaatcctggacatcagctgtacgag
aagctgattggtgggaagtacatgggtgagcttgtgcgtcttgtgctgctcaaactggtg
aatgaagatctgctgttcaacggcgaagcctcagacctgctgaaaacgcgaggagctttt
gaaacacgctttgtctcccagattgagagtgacacaggggacagaaagcagatctacaac
atcctcagttgtctgggaatcctgccatcagagctggactgtgatattgtgcgtctggcg
tgtgagagtgtgtctacgcgagcggctcacctgtgcggggcaggactcgccggcgtcatt
aacctcatgagagagcgacgctgccaggaggagctaaagatcactgtgggggtggatgga
tctgtctacaaactacaccctcatttcaaggaacgtttccataagcttgtgtgggaattg
actcctcactgtgaaattacctttatccagtcagaagaaggcagcggtcgtggagcggcg
ctcatttctgctgtggcgtgcaagatggccgcctgcatgctgacgccttga

DBGET integrated database retrieval system