KEGG   Danio rerio (zebrafish): 751668Help
Entry
751668            CDS       T01004                                 

Gene name
gck, fb57f10, glk, hex4, wu:fb57f10, zgc:153643
Definition
glucokinase (hexokinase 4) (EC:2.7.1.2)
Orthology
K12407  
glucokinase [EC:2.7.1.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    751668 (gck)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    751668 (gck)
   00052 Galactose metabolism
    751668 (gck)
   00500 Starch and sucrose metabolism
    751668 (gck)
   00520 Amino sugar and nucleotide sugar metabolism
    751668 (gck)
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    751668 (gck)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    751668 (gck)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     751668 (gck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Position
8
AA seq 476 aa AA seqDB search
MPCLTSARRQRIPSDFESVLEKILMVDQILSEFVLSKEELEEVMRRMRREMERGLRVETH
DEASVKMLPTYVRSTPEGSEVGDFLALDLGGTNFRVMLVKVGEDEERGWKVETKHHMYSI
PEDAMTGTAEMLFDYIAGCISDFLDKHNLKHKKLPLGFTFSFPVRHEDLDKGILLNWTKG
FKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRSCEVGMIVGTGC
NACYMEEMRKVELVEGEEGRMCVNTEWGAFGDHSELEDFRLEYDRVIDETSLNPGHQLYE
KLIGGKYMGELVRLVLLKLVNEDLLFNGEASDLLKTRGAFETRFVSQIESDTGDRKQIYN
ILSCLGILPSELDCDIVRLACESVSTRAAHLCGAGLAGVINLMRERRCQEELKITVGVDG
SVYKLHPHFKERFHKLVWELTPHCEITFIQSEEGSGRGAALISAVACKMAACMLTP
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgtcttacttcagcccgtagacagaggataccgagcgactttgagtcagtgctg
gagaaaatcctcatggtggaccaaattctgtctgagtttgtgttgagtaaagaagagctg
gaggaggtgatgaggcgaatgcggagagagatggagagaggactgcgtgtggagacacat
gatgaagccagtgtcaaaatgttgcccacgtatgtccggtccacacctgaaggctccgag
gttggtgatttcctggcactggatcttggagggacaaattttcgagtgatgcttgtgaaa
gtgggtgaggatgaagagcgaggctggaaggtggaaaccaaacatcacatgtactccatc
cctgaagatgccatgaccggcacagctgaaatgttgtttgattacattgccggctgcata
tctgacttcctggacaaacataatctcaaacacaagaagctaccactgggattcaccttc
tcttttccagtgcgtcacgaggatttggacaaggggattcttctgaactggactaaaggc
ttcaaggcctctggcgctgagggcaataatgttgtgggtcttctgagagacgccatcaaa
agaagaggggactttgaaatggatgtggtggccatggtgaacgacacagtagccaccatg
atctcctgctactatgaagaccgcagctgtgaagtcggcatgatagtaggtacaggctgc
aatgcgtgttatatggaggagatgcgtaaggtggagctggttgaaggagaggagggccgg
atgtgtgtgaacacagaatggggggcatttggggaccacagtgaactggaggacttcagg
ctggaatacgaccgtgttattgatgagacgtcactcaatcctggacatcagctgtacgag
aagctgattggtgggaagtacatgggtgagcttgtgcgtcttgtgctgctcaaactggtg
aatgaagatctgctgttcaacggcgaagcctcagacctgctgaaaacgcgaggagctttt
gaaacacgctttgtctcccagattgagagtgacacaggggacagaaagcagatctacaac
atcctcagttgtctgggaatcctgccatcagagctggactgtgatattgtgcgtctggcg
tgtgagagtgtgtctacgcgagcggctcacctgtgcggggcaggactcgccggcgtcatt
aacctcatgagagagcgacgctgccaggaggagctaaagatcactgtgggggtggatgga
tctgtctacaaactacaccctcatttcaaggaacgtttccataagcttgtgtgggaattg
actcctcactgtgaaattacctttatccagtcagaagaaggcagcggtcgtggagcggcg
ctcatttctgctgtggcgtgcaagatggccgcctgcatgctgacgccttga

DBGET integrated database retrieval system