KEGG   Danio rerio (zebrafish): 751668Help
Entry
751668            CDS       T01004                                 

Gene name
gck
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00010  Glycolysis / Gluconeogenesis
dre00052  Galactose metabolism
dre00500  Starch and sucrose metabolism
dre00520  Amino sugar and nucleotide sugar metabolism
dre00524  Neomycin, kanamycin and gentamicin biosynthesis
dre01100  Metabolic pathways
dre01200  Carbon metabolism
dre04910  Insulin signaling pathway
Module
dre_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dre_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    751668 (gck)
   00052 Galactose metabolism
    751668 (gck)
   00500 Starch and sucrose metabolism
    751668 (gck)
   00520 Amino sugar and nucleotide sugar metabolism
    751668 (gck)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    751668 (gck)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    751668 (gck)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     751668 (gck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 751668
NCBI-ProteinID: NP_001038850
ZFIN: ZDB-GENE-060825-204
Ensembl: ENSDARG00000068006
UniProt: F1RC38
Position
8
AA seq 476 aa AA seqDB search
MPCLTSARRQRIPSDFESVLEKILMVDQILSEFVLSKEELEEVMRRMRREMERGLRVETH
DEASVKMLPTYVRSTPEGSEVGDFLALDLGGTNFRVMLVKVGEDEERGWKVETKHHMYSI
PEDAMTGTAEMLFDYIAGCISDFLDKHNLKHKKLPLGFTFSFPVRHEDLDKGILLNWTKG
FKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRSCEVGMIVGTGC
NACYMEEMRKVELVEGEEGRMCVNTEWGAFGDHSELEDFRLEYDRVIDETSLNPGHQLYE
KLIGGKYMGELVRLVLLKLVNEDLLFNGEASDLLKTRGAFETRFVSQIESDTGDRKQIYN
ILSCLGILPSELDCDIVRLACESVSTRAAHLCGAGLAGVINLMRERRCQEELKITVGVDG
SVYKLHPHFKERFHKLVWELTPHCEITFIQSEEGSGRGAALISAVACKMAACMLTP
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgtcttacttcagcccgtagacagaggataccgagcgactttgagtcagtgctg
gagaaaatcctcatggtggaccaaattctgtctgagtttgtgttgagtaaagaagagctg
gaggaggtgatgaggcgaatgcggagagagatggagagaggactgcgtgtggagacacat
gatgaagccagtgtcaaaatgttgcccacgtatgtccggtccacacctgaaggctccgag
gttggtgatttcctggcactggatcttggagggacaaattttcgagtgatgcttgtgaaa
gtgggtgaggatgaagagcgaggctggaaggtggaaaccaaacatcacatgtactccatc
cctgaagatgccatgaccggcacagctgaaatgttgtttgattacattgccggctgcata
tctgacttcctggacaaacataatctcaaacacaagaagctaccactgggattcaccttc
tcttttccagtgcgtcacgaggatttggacaaggggattcttctgaactggactaaaggc
ttcaaggcctctggcgctgagggcaataatgttgtgggtcttctgagagacgccatcaaa
agaagaggggactttgaaatggatgtggtggccatggtgaacgacacagtagccaccatg
atctcctgctactatgaagaccgcagctgtgaagtcggcatgatagtaggtacaggctgc
aatgcgtgttatatggaggagatgcgtaaggtggagctggttgaaggagaggagggccgg
atgtgtgtgaacacagaatggggggcatttggggaccacagtgaactggaggacttcagg
ctggaatacgaccgtgttattgatgagacgtcactcaatcctggacatcagctgtacgag
aagctgattggtgggaagtacatgggtgagcttgtgcgtcttgtgctgctcaaactggtg
aatgaagatctgctgttcaacggcgaagcctcagacctgctgaaaacgcgaggagctttt
gaaacacgctttgtctcccagattgagagtgacacaggggacagaaagcagatctacaac
atcctcagttgtctgggaatcctgccatcagagctggactgtgatattgtgcgtctggcg
tgtgagagtgtgtctacgcgagcggctcacctgtgcggggcaggactcgccggcgtcatt
aacctcatgagagagcgacgctgccaggaggagctaaagatcactgtgggggtggatgga
tctgtctacaaactacaccctcatttcaaggaacgtttccataagcttgtgtgggaattg
actcctcactgtgaaattacctttatccagtcagaagaaggcagcggtcgtggagcggcg
ctcatttctgctgtggcgtgcaagatggccgcctgcatgctgacgccttga

DBGET integrated database retrieval system