KEGG   Danio rerio (zebrafish): 767655Help
Entry
767655            CDS       T01004                                 

Gene name
josd1, zgc:153682
Definition
Josephin domain containing 1 (EC:3.4.19.12)
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     767655 (josd1)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C86
   767655 (josd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
12
AA seq 235 aa AA seqDB search
MGSTPCSGKGRGVGGFQELGCMPWKVSKQKGEALGGRGSELEDRPNAGTPPTSLQPPAIY
HEKQHRELCALHALNNVFQDGAAFSRDALQDIYQRLSPSTLVTPHKKNMLGNGNYDVNVI
MAALQTRGFEAVWWDKRRDVGSIALPNVTGFILNVPSNLRWGPLRLPLKRQHWIGVREVA
GVYYNLDSKLRSPHAIGTADELRKFLRHQLRGKNCELLLVVSEEVEVHQTWKSDN
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggggagtactccatgttctggtaaggggaggggggtcgggggctttcaggagttgggt
tgtatgccatggaaggtcagcaagcaaaaaggagaagccttaggtggacgtgggtccgag
ctggaggacaggccgaatgctggaacgccccccacctcgttgcaacctcctgcaatttat
catgaaaagcagcatcgggagttgtgtgctctgcatgcgctaaacaatgtcttccaggat
ggagcggcgttcagtcgtgatgcacttcaggacatctaccagaggctctctcctagcact
ttggtcacaccccacaagaaaaacatgctgggtaatggcaactatgacgtgaatgtcatc
atggctgcattgcagactcgtggatttgaggcagtttggtgggacaagagaagggacgtc
ggtagcattgcactgccaaacgtcactggtttcatcttgaatgtgccatccaatttgcgc
tggggcccattgcgtctgcccctcaagcggcagcactggattggtgtgcgagaagtggca
ggagtttactataacctagactctaaactgcgcagccctcatgccattggaacagctgat
gaactgaggaagttcttgcgtcaccagcttcgagggaagaactgtgaactcctattggtc
gtctcagaggaggtggaagtgcatcagacatggaagtctgataactga

DBGET integrated database retrieval system