KEGG   Danio rerio (zebrafish): 767655Help
Entry
767655            CDS       T01004                                 

Gene name
josd1
Definition
(RefSeq) josephin-1
  KO
K15235  josephin [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     767655 (josd1)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C86
   767655 (josd1)
Ubiquitin system [BR:dre04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    767655 (josd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Josephin DUF3788
Motif
Other DBs
NCBI-GeneID: 767655
NCBI-ProteinID: NP_001070063
ZFIN: ZDB-GENE-060929-260
Ensembl: ENSDARG00000071548
Vega: OTTDARG00000036562
UniProt: Q08C38
Position
12
AA seq 235 aa AA seqDB search
MGSTPCSGKGRGVGGFQELGCMPWKVSKQKGEALGGRGSELEDRPNAGTPPTSLQPPAIY
HEKQHRELCALHALNNVFQDGAAFSRDALQDIYQRLSPSTLVTPHKKNMLGNGNYDVNVI
MAALQTRGFEAVWWDKRRDVGSIALPNVTGFILNVPSNLRWGPLRLPLKRQHWIGVREVA
GVYYNLDSKLRSPHAIGTADELRKFLRHQLRGKNCELLLVVSEEVEVHQTWKSDN
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggggagtactccatgttctggtaaggggaggggggtcgggggctttcaggagttgggt
tgtatgccatggaaggtcagcaagcaaaaaggagaagccttaggtggacgtgggtccgag
ctggaggacaggccgaatgctggaacgccccccacctcgttgcaacctcctgcaatttat
catgaaaagcagcatcgggagttgtgtgctctgcatgcgctaaacaatgtcttccaggat
ggagcggcgttcagtcgtgatgcacttcaggacatctaccagaggctctctcctagcact
ttggtcacaccccacaagaaaaacatgctgggtaatggcaactatgacgtgaatgtcatc
atggctgcattgcagactcgtggatttgaggcagtttggtgggacaagagaagggacgtc
ggtagcattgcactgccaaacgtcactggtttcatcttgaatgtgccatccaatttgcgc
tggggcccattgcgtctgcccctcaagcggcagcactggattggtgtgcgagaagtggca
ggagtttactataacctagactctaaactgcgcagccctcatgccattggaacagctgat
gaactgaggaagttcttgcgtcaccagcttcgagggaagaactgtgaactcctattggtc
gtctcagaggaggtggaagtgcatcagacatggaagtctgataactga

DBGET integrated database retrieval system