KEGG   Danio rerio (zebrafish): 767657Help
Entry
767657            CDS       T01004                                 

Gene name
abhd12
Definition
(RefSeq) monoacylglycerol lipase ABHD12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     767657 (abhd12)
Peptidases [BR:dre01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   767657 (abhd12)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   767657 (abhd12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
17
AA seq 382 aa AA seqDB search
MRKRKGSADHDSSFTATLTDGSSDLKQCHKGTDADTDPGGSGKEMGRRCRRGGLMWRLRR
ILIWLLGIYIAIPVIIKVCPSIQAKLVFLNFVRVPYFIDLKRPQDQGMNHTHNFYLQPEE
GINIGVWHTVPAGMWREAQAKDAEWYEKSFQSSHPVILYLHGNAGTRGGDHRVQLYKVLS
SLGYHVVTFDYRGWGDSEGSPSERGMTSDALFLYQWIKQRIGPKPLYIWGHSLGTGVATN
LVRRLCDRGTPPDALILESPFTNIREEAKSHPFSMVYRYLPGFDWFFLDAISANDIRFAS
DENVNHISCPVLILHAEDDTVVPFQLGKKLYDLAAQSKSLNGHKVQFIPFSSSLGYRHKF
IYKSPQLPNILSDFLRAPHPHG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaagcgaaaaggcagcgcagatcatgacagctcgttcacggctacattaacggac
ggcagctccgatctaaagcagtgccacaaagggacagacgctgatactgatcctggaggc
tcggggaaggagatgggaagacggtgcaggaggggtggtttgatgtggaggttgcggagg
atactgatctggcttctgggaatctacatcgccatccctgttatcatcaaagtctgtcca
tcaatacaagcaaaattagtatttttaaactttgtgcgggtaccgtattttatagatttg
aaaagaccgcaggatcagggtatgaatcacactcacaacttctacctgcagccagaggaa
ggaatcaacattggagtgtggcacacagtaccagcaggtatgtggagggaggctcaggct
aaagatgctgaatggtatgagaaaagcttccagtccagtcacccagtcatcctgtacctc
cacggcaatgctgggacgagaggaggagatcacagagtacagctttataaggttctcagt
tcattaggctaccatgtagtcacgtttgattatagaggttggggagactctgagggcagt
ccttcagagagaggcatgacatcagatgctctgttcctctaccagtggataaaacagcgg
attggaccgaagccgctgtacatttggggtcactcgctcggcacaggagtggccactaac
cttgtgagacggctgtgtgacaggggaacgcctccagacgccctgattttagagtcaccc
tttacaaacatcagagaggaagccaagagccatcccttctccatggtttacagatattta
ccgggatttgactggttcttcctggatgctataagtgcaaacgacatccgatttgccagt
gatgagaatgtgaaccacatctcatgtccagttctgatcctgcatgccgaagacgacaca
gttgtgccctttcagctagggaagaagctgtatgatttggcggctcagagtaaaagtctg
aatggtcataaggtccagttcatcccgttctccagttctctgggctacagacacaagttc
atctacaagagcccacagctaccaaatatactgagtgattttctaagagctcctcatccc
cacggttag

DBGET integrated database retrieval system