KEGG   Danio rerio (zebrafish): 767715Help
Entry
767715            CDS       T01004                                 

Gene name
srd5a1, zgc:153768
Definition
steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) (EC:1.3.1.22)
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
dre  Danio rerio (zebrafish)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    767715 (srd5a1)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     767715 (srd5a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
19
AA seq 265 aa AA seqDB search
MDALLNTLFSSEEEELYVLDCLSYLMMAMALITFVALLFEHVPYGRYASSRFGFPVNVKL
AWFVQELPSFLLPLSLALWSSSSKIIHLPNQLLLLMFVCHYMQRSLIYPFLIRGGKSTPF
ISLVLAFVFCIYNGYLQGRYLSHYADYPADWVTHPCFIIGSCMWFLGWIINMHSDHILRN
LRKPGETGYKIPRGGMFEYVSGANFFGEIVEWAGFALAGQSIHSAAFALFTLIVLSSRGM
DHHKWYLTKFEDYPKSRKALIPFLL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggacgctcttctgaatacgttattttcttctgaggaggaagaattgtacgttttggat
tgcttatcgtatctgatgatggccatggctctgataacttttgttgctttactctttgag
catgtgccctatggcaggtatgcatccagcaggtttggattccctgtaaatgtcaagttg
gcttggttcgttcaagagctgccttcttttttgttgcctttgagtttagctttatggagt
tcaagttcaaaaataatccacctgcccaaccaactcctcctgctcatgttcgtttgccat
tatatgcaaaggtctctcatctacccgtttttaattagaggagggaaatcaacaccgttc
atctccctagttctagcctttgtcttctgcatctataatgggtacctccaaggtagatac
ctgagtcactatgctgattacccagctgattgggttacacacccctgcttcatcataggg
tcttgtatgtggttcctgggatggattattaatatgcactctgaccatatcctcaggaac
ctccgtaaacctggagaaacaggttataaaatacctagaggaggcatgtttgagtatgtg
tctggagcaaacttctttggagagattgtggaatgggctggatttgctttagctggtcaa
tccatccatagtgcagcttttgctctcttcactcttatcgtgctgtccagcagaggaatg
gaccaccacaagtggtatctgacaaaatttgaggactatccaaaatcaaggaaagcttta
ataccgtttctgctctga

DBGET integrated database retrieval system