KEGG   Danio rerio (zebrafish): 767784Help
Entry
767784            CDS       T01004                                 

Gene name
clk2b, zgc:153684
Definition
CDC-like kinase 2b
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
16
AA seq 500 aa AA seqDB search
MPHSRRYPSSERTRSRSRSRHMRYERHRRRRRSRTRSRSRSISSRSRRRHRERRHRDSSS
RRSSYQQPSGERRRSSRRYCRDEREEFDRDYTFTDGYFRHTRSRDHRTERDSGRRRRRRR
TRTRTRTRSRTRSYSQSRSISSKAWAVKDDEEGHLIYRAGDVLQDRYEITQTLGEGTFGK
VVECVDHQRGGSRIALKIIKNVEKYKEAARLEINVLEKINQRDPENKNLCVQMLDWFDYH
GHMCLSFELLGLSTFDFMKENNYLPYSISQVRHMAYQICLAVKFLHDNKLTHTDLKPENI
LFVSSDYSVLYNAEKKRDERSVNSTAVRIVDFGSATFDHEHHSSIVSTRHYRAPEVILEL
GWSQPCDVWSIGCILFEFYCGYTLYQTHDNREHLAMMERIHGPVPSRMIRKTRKQKYFYR
GRLDWDESTSAGRYVRENCRPLRRYMLCESEDHHQFFDLLEGLLEYEPEQRLSLSAALRH
PFFSLLRDTEHFSGGRDISR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcctcactctcggcggtacccgtcatcggagcggacccgcagccggagcaggagccgt
cacatgcggtatgagcggcaccgtcgcagacgacgcagccgaacacgcagtcgcagccgt
tctatatcatcccggagcaggagacgccatcgggagagacgccacagagacagcagctcc
aggaggtccagctaccagcagccatccggcgagcgcaggaggagcagcagacgctactgt
cgggacgagcgggaggagtttgaccgagactacaccttcacagacggatatttcagacac
acacgctctcgagatcaccgtacagagagagacagcggacgcagacggagacgccgcaga
accaggaccaggaccagaactcgatccagaacacgctcatacagccagagccggtccata
tcatcaaaagcgtgggcggttaaagacgatgaggagggtcatctgatctatcgggccggt
gatgtgctgcaggacagatacgagatcacgcagacgctcggagagggaaccttcgggaaa
gtggtggagtgtgtggatcatcagaggggaggctctcgcatcgctctgaagatcattaag
aatgttgagaaatataaagaagcagctcgactggagatcaacgtgctggagaagatcaac
cagagagatccagaaaacaagaatctgtgtgtgcagatgttggactggttcgattatcac
ggccacatgtgtctgagtttcgagctgctgggtctcagtaccttcgacttcatgaaggag
aataattacctgccgtactccatcagtcaggtcagacacatggcctaccagatctgcctc
gctgtcaagtttctccatgacaacaagctgacccacactgacctgaagccggagaatatc
ctgtttgtgagctcagactatagtgtgctgtacaacgcagagaagaagcgtgacgagcgc
tccgtgaacagcactgcagtgaggattgtggatttcggcagcgccacctttgaccacgag
catcacagcagcatcgtctccacacgacactacagagcgccagaggtcattctggagctg
ggctggagtcagccgtgtgacgtctggagtatcggctgtatactgtttgagttctactgc
ggatacacactctaccagactcatgataacagagagcatctggccatgatggagcgaata
catggacctgttccttccagaatgatacgcaaaacgaggaagcagaagtacttctacaga
ggtcgtctggactgggatgagagcacgtcagcgggccgatacgtcagagagaactgcagg
ccgctgaggaggtatatgctgtgtgagtcggaggatcatcatcagttctttgatttgctg
gagggcttgttggagtacgagccggagcagcgtttgtctctctccgctgcgctccggcat
cccttcttcagtctcctccgagacaccgaacacttcagtggaggccgtgacattagccgg
tga

DBGET integrated database retrieval system