KEGG   Danio rerio (zebrafish): 768201Help
Entry
768201            CDS       T01004                                 

Gene name
usp37, wu:fi15b04, wu:fi38d03, zgc:152882, zgc:153999
Definition
ubiquitin specific peptidase 37 (EC:3.4.19.12)
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
9
AA seq 938 aa AA seqDB search
MAAAVPRLTSGGAVRIRIRCGELGTTKWREGVIEIQERDNKINLLVKFNSGGAPRVFQLS
HNVKSVSWFQTHGPNRMTQTLKDSCIVMMDKLNMLVAKKMKEYLENVKLGKPAVFKTNQG
SASFGLVLGNRTAQNDSGLSPSDKQSAPRRSSLDNREDSTPRKPLGSPSRVTSTPARGSF
SEIRSEKRKRLMNSDGDLTEDYPKENDSSSNNKAITDSSRKFLLSCKDKLKQSEENRASA
PHTPAPLQPTSFYGSRTGAKDYTQTHSFLDRPSSTGSCPSAKRSLVLPNHSTPFKKVRPT
LDYGGWNKPRPSVLAQPQPPLQGFSNLGNTCYMNAILQSLFSLPSFSNDLLKQGIPWKRV
PINALLRRFAHLLAKKDISPPEVKKDLLRRVKNAISSTAERFSGYMQNDAHEFLSQCLDQ
LKEDVEKINKSWKNEPSAWDEPQSMRLADEVDTSRIYTCPVTVNMEFEVQHTITCKSCGE
VVLKREQFNDLSIDLPRRRKTLPMRSIQDSLDLFFRMEEIEYSCEKCSGKVATVSHKFSR
LPRVLILHLKRYSYNTQLSLNSKLGQQVLIPKYLTLLSHCTDATRSPLSLGWSAQNALSR
TLKISQSVNSSTLRKASQRPESSGSVLCDSDSDVELVRKVARKHHPDDDRADEQHHHHHP
HAAVEQSEFNGINDEEMLAAVLEMSRHDTSLCAGPDEEPSSSPDTGFGDADAHDLTQHLE
LLDAEKQPTDALESPDLTMDENKENQTPDGLQGELDWVQQYSLEQEREEQELQQALAQSL
QEQEAREMREDDDLKRATELSLQEFNNSLPELLCSDEDSGNEDGLDMEYSEAEAEELKKN
AETGELPNSFRLISVVSHIGSSSSSGHYISDVYDMKKQSWLTYNDLDVSRTQESTVQRDR
DRSGYIFFYMHKDVFEELSELEKAGVNTDGGRTVLQPL
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcagtgcccaggctgaccagcggtggcgctgtccgcatccgcatcaggtgt
ggtgaactggggaccaccaagtggagagagggggtaattgagatccaggagagagacaac
aaaatcaacctgctggtcaagttcaacagcggaggagctccgagggtttttcagctgagt
cacaatgtgaagagtgtttcgtggtttcaaacgcacgggccgaaccgcatgacacagact
ctgaaagactcctgcatcgtcatgatggacaagctcaacatgctggtcgccaaaaagatg
aaggaatatctagaaaatgtgaagcttggtaaacctgcagttttcaagacgaaccagggc
agtgctagttttgggctggttcttggaaatcgaacagcacagaacgactcaggcctttct
ccgtcagataaacagagtgctcccaggcgttccagtctggacaacagagaggacagcacc
cctcgaaagcccctgggcagccccagccgggtcacgtccacaccggcccgcggcagcttc
tcggagatcaggagtgagaagaggaagaggctgatgaactctgacggagacctgacggag
gactatcccaaagagaacgactcttccagcaacaataaggccatcacagactcctctaga
aagttcctgctcagctgcaaagacaagctcaagcagtcggaggagaacagagcctctgct
ccacacactcctgctcctctccagcccacgtctttctacgggagccgaacaggagctaaa
gactacacgcaaacgcattcatttctggacaggcccagcagcacaggttcatgtccatca
gccaaaagaagcctagttttgcccaatcactccacgccctttaaaaaggttcgtcccacg
ctggattacggaggttggaacaaacccagaccctcagtgctggcccagcctcagcctcca
ctgcaaggattctccaatcttgggaacacgtgctacatgaacgccatcctccagtctctc
ttcagcctgccctccttttccaatgacctgttgaagcagggcatcccgtggaagagggtt
cccattaacgcccttctcaggcgattcgctcatctgctggcaaagaaagacatttcccct
ccagaggtcaagaaagatcttctgcggcgagtgaagaacgccatttcttcaacagcggag
cgattctctggatacatgcagaacgatgctcatgagtttctgagtcagtgtctggaccag
ctgaaggaggatgtggagaagatcaacaagagctggaagaacgagccgtcggcatgggac
gagcctcagagcatgcggttagcagacgaggtggacacgtcacgcatctacacctgtcct
gtcactgtcaacatggagtttgaggtgcagcacaccatcacctgcaaaagctgtggagag
gtggtgctgaagcgagaacagttcaatgatctgtccatcgacctgccacgcaggaggaaa
accctccccatgaggtctatacaggactctctggatctcttcttcaggatggaggaaatc
gagtattcctgtgaaaagtgcagcggaaaagtggcgactgtttctcacaaatttagcaga
cttcccagggtgttgattctgcacctcaaacgctacagctacaacactcagctctcctta
aacagcaaactgggtcaacaagtgctgatccccaaatatctgacgctgctgtcccactgc
acagacgccacccgcagcccgctcagcctgggctggagtgcacagaacgccctgtctcgg
acactgaagatctcgcagtccgtcaactcttcgacactgaggaaagcgtcccagaggccg
gagagttcaggcagtgtgctgtgtgactctgacagcgatgtggagctggtcagaaaagtc
gcccgcaaacatcatccagacgacgacagggcagacgagcagcatcatcatcatcatcct
catgcagcagtggagcagtcggagtttaatggtattaatgatgaggagatgctggcggct
gtgctggagatgagccgtcacgacaccagtctctgcgcaggcccagacgaggagcccagc
agcagcccagacaccggcttcggggacgcagacgcacatgacctgacgcaacatctggag
ctgctggatgcagagaaacagcccacagatgcactggagtctccggatctcaccatggat
gagaataaagagaaccagacgccggacgggctgcagggcgagctggactgggtgcagcag
tacagtctggagcaagagcgcgaggagcaggagctgcagcaggcactcgctcagagtctg
caggagcaggaggcgagagagatgagagaagatgatgatctgaagagggcaactgaactc
agcctgcaagagtttaataactctctgccggagctgctgtgctctgatgaggactccggg
aatgaggacggtctggatatggagtacagcgaggcggaggccgaagagcttaagaagaac
gcagagactggagaactgcccaactctttcagactcatcagtgtggtcagtcacatcggc
agcagctcctcttcagggcactacatcagcgacgtctacgacatgaagaaacagtcctgg
ttgacatataatgatctggacgtgtcgcgcacgcaggagtccacagtccagagagatcga
gaccgcagcggatacatctttttctacatgcacaaagatgtgttcgaggagctgtcggag
ctggagaaggccggagtgaacacagatggaggtcggacggtgctacagccgctataa

DBGET integrated database retrieval system