KEGG   Danio rerio (zebrafish): 777730Help
Entry
777730            CDS       T01004                                 

Gene name
cdk4, zgc:153726
Definition
cyclin-dependent kinase 4 (EC:2.7.11.22)
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
dre  Danio rerio (zebrafish)
Pathway
Cell cycle
p53 signaling pathway
Tight junction
Module
Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    777730 (cdk4)
   04115 p53 signaling pathway
    777730 (cdk4)
  Cellular commiunity
   04530 Tight junction
    777730 (cdk4)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     777730 (cdk4)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   777730 (cdk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
11
AA seq 297 aa AA seqDB search
MAQEVGLQYEPVAEIGGGAYGTVYKARDRDSGQFVALKSVRVQTNQDGLPLSTVREVALL
KRLEQFDHPNIVRLMDVCATLRTDQETKVTLVFEHVDQDLRAYLEKVPAPGLPVDKIRDL
MQQLLCGLAFLHTNRVLHRDLKPENILVTSRGQVKLADFGLARIYSCHMALTPVVVTLWY
RSPEVLLQSTYATPVDIWSTGCIFAEMFRRKPLFCGDSEADQLGKIFAVIGLPAEDQWPT
DVTLSHHNFSPQSPRPITDCVPDITEKGAELLLKMLTFDPLKRISALNALDHPFFSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggaggtggggctgcagtatgagccagtagcagagatcgggggcggggcttac
gggaccgtctataaggctcgggatcgggacagcgggcagtttgtggcgctgaagagcgtt
cgggtgcagaccaatcaggacggactcccactgtccacggttcgagaggtggctctgctg
aagcgcctggagcagttcgaccatcccaacatcgtcaggctgatggacgtgtgcgcgacc
ctcaggacggatcaggagactaaagtgacgctggtgtttgaacatgtggatcaggatctc
agggcatacctggagaaagttccagcaccgggactgcctgtggacaaaatcagagacctg
atgcagcagctgctgtgtggtctggcgttcctgcacactaatcgagttctccatcgggat
ctgaagccggagaacatcctggtgaccagcagagggcaggtgaagctggcggactttggg
ctggcgcgcatctacagctgccacatggcactgaccccggtggtggtgacgctgtggtat
cgctctcctgaggtgctcctgcagagcacatacgccacaccagtggacatctggagcacc
ggctgcatctttgccgagatgttcagacgcaagcctctgttctgcggagattcagaggcg
gaccagctggggaagatctttgcggtgatcggtctgccggcggaggatcagtggcccaca
gacgtcactctttcccaccacaacttcagccctcagagccctcggccaatcacagactgc
gttccggacatcacagagaaaggggcggagctattgctgaaaatgctgaccttcgacccg
ctgaagaggatctctgcgctgaacgctctggatcatcccttcttcagcgagtga

DBGET integrated database retrieval system