KEGG   Danio rerio (zebrafish): 777730Help
Entry
777730            CDS       T01004                                 

Gene name
cdk4, zgc:153726
Definition
(RefSeq) cyclin-dependent kinase 4 (EC:2.7.11.22)
  KO
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
dre  Danio rerio (zebrafish)
Pathway
Cell cycle
p53 signaling pathway
Tight junction
AGE-RAGE signaling pathway in diabetic complications
Module
Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    777730 (cdk4)
   04115 p53 signaling pathway
    777730 (cdk4)
  Cellular commiunity
   04530 Tight junction
    777730 (cdk4)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    777730 (cdk4)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     777730 (cdk4)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   777730 (cdk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
11
AA seq 297 aa AA seqDB search
MAQEVGLQYEPVAEIGGGAYGTVYKARDRDSGQFVALKSVRVQTNQDGLPLSTVREVALL
KRLEQFDHPNIVRLMDVCATLRTDQETKVTLVFEHVDQDLRAYLEKVPAPGLPVDKIRDL
MQQLLCGLAFLHTNRVLHRDLKPENILVTSRGQVKLADFGLARIYSCHMALTPVVVTLWY
RSPEVLLQSTYATPVDIWSTGCIFAEMFRRKPLFCGDSEADQLGKIFAVIGLPAEDQWPT
DVTLSHHNFSPQSPRPITDCVPDITEKGAELLLKMLTFDPLKRISALNALDHPFFSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggaggtggggctgcagtatgagccagtagcagagatcgggggcggggcttac
gggaccgtctataaggctcgggatcgggacagcgggcagtttgtggcgctgaagagcgtt
cgggtgcagaccaatcaggacggactcccactgtccacggttcgagaggtggctctgctg
aagcgcctggagcagttcgaccatcccaacatcgtcaggctgatggacgtgtgcgcgacc
ctcaggacggatcaggagactaaagtgacgctggtgtttgaacatgtggatcaggatctc
agggcatacctggagaaagttccagcaccgggactgcctgtggacaaaatcagagacctg
atgcagcagctgctgtgtggtctggcgttcctgcacactaatcgagttctccatcgggat
ctgaagccggagaacatcctggtgaccagcagagggcaggtgaagctggcggactttggg
ctggcgcgcatctacagctgccacatggcactgaccccggtggtggtgacgctgtggtat
cgctctcctgaggtgctcctgcagagcacatacgccacaccagtggacatctggagcacc
ggctgcatctttgccgagatgttcagacgcaagcctctgttctgcggagattcagaggcg
gaccagctggggaagatctttgcggtgatcggtctgccggcggaggatcagtggcccaca
gacgtcactctttcccaccacaacttcagccctcagagccctcggccaatcacagactgc
gttccggacatcacagagaaaggggcggagctattgctgaaaatgctgaccttcgacccg
ctgaagaggatctctgcgctgaacgctctggatcatcccttcttcagcgagtga

DBGET integrated database retrieval system