KEGG   Danio rerio (zebrafish): 792596Help
Entry
792596            CDS       T01004                                 

Gene name
hdac7b, hdac7, si:ch211-4c18.2
Definition
(RefSeq) histone deacetylase 7b
  KO
K11408  
histone deacetylase 7 [EC:3.5.1.98]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     792596 (hdac7b)
Chromosome [BR:dre03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     792596 (hdac7b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
6
AA seq 751 aa AA seqDB search
MSHHQQHRTLERGRRSTQEDKLSLRKESEQTGAGCSLSVRRKLYEYICNKQHRTSAGQDI
QQRELDRQEEDNPLRRTASEPILKLRSKRSMTGRQNPLQRKTSAPPAVGDPDSMAVSASS
ATVSSLDNQMNRQELIQTTTYSASSGKEDSPLQISIQHPVLWPAYAATAYNPQVFTLYPH
IFTVTGQQWPPMPHRPLIKSQSAPSYIQQYTHIHTPAYTLVQPMYQQQWPQETFQQHTLP
EKVSVGPAWPESPGDLGRFRKRTSEEVRISSQSPLESCNRQGVQLKENLEWRHKIFHQQV
SRVHSFPDTFDTRLSSHSASALDMRKPNFTTGLVYEMMKHRCDCRDSSCGLHEADRVTSI
WSRLQECGLRSQCKLLKGRSATVEELLSVHSEELVCFFTGPEPYRSQMDIGTMWKNPRNS
EALKMAVGSVTELALCVARGDLRNGFAVVTPPGHHASRSQTLDSIVFNSVAIAAKQLQEQ
LKVKKILIVDWDVHHGSGTESIFYTDPSVLYISLHRYDDGAFFNGTGDPSRVGCDVGRGY
NVNVAWSGGLRPPMGDAEYLAAFRTVVMPIAHEFSPNVVLVSAGFDAAEGHPAALGGYRV
SPKCFGWLTQKLMELAEGRVVLVLEGGYELVSLCDASQACVSALLGNEPEPLSEVELLRS
PCANAVCSLEKVLHVQSLHWRSVRSMLNTVSLSYVKAERRVSAGSEAALVLSGLNMTVPH
RRQLPNEPVEDDETHSTVSFTRRTFSFQSRS
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaccatcagcagcaccggacactggagagagggaggaggagcacacaagaggac
aaactgtctttgaggaaagagagcgaacaaacaggtgctggctgtagtctctcggtgaga
agaaagctgtatgagtatatctgcaataagcagcacaggacatctgcaggtcaggacata
cagcagcgtgaattagaccgacaggaagaggacaatccactaagaagaacagcctctgag
cctattctgaagctgcgatcaaagagaagtatgacggggagacagaatccattgcagcgt
aaaaccagcgcgccccctgctgtcggggatccagactccatggcggtttctgccagttct
gctacagtttcatcactagataatcaaatgaatcgtcaagagctgattcaaaccacaacc
tacagtgcatcatcaggcaaggaagactctcctttacaaatcagcattcagcaccccgtc
ctctggcctgcatatgctgccactgcttacaatcctcaggtcttcactctttatccacat
atttttacagttactgggcagcagtggccgccgatgcctcatagacctttaatcaaatcc
cagtcagcaccttcttatatacagcaatacacacatatacacactccggcttatacactg
gtacaacccatgtaccaacaacagtggccacaagagacattccagcaacacacccttcca
gaaaaggtttcagttggcccagcatggcctgagtctcctggagatctgggaaggttcaga
aagagaacaagtgaggaagtacgcatttcatctcaatccccgcttgaaagctgtaatcga
cagggagttcagctgaaagaaaacttggaatggagacacaaaatatttcaccagcaggtt
tcacgtgtgcattcctttccagacacctttgacacacgtctgtcttcacattcagcctca
gctctggacatgagaaaaccaaacttcaccacaggcttggtgtatgagatgatgaagcat
aggtgtgactgtagagacagcagctgtggtcttcatgaagctgaccgagttacaagtatc
tggtcaagactgcaggagtgtggcctgaggagtcagtgtaagctgcttaaaggcaggtca
gccactgtcgaggagctactctcagtccattcagaggaacttgtttgttttttcactgga
ccagaaccatatcgaagtcaaatggacattggtacgatgtggaaaaatcccagaaattca
gaggcactgaagatggctgttggtagcgtgacagagctagcgctgtgtgtggccagagga
gacctgaggaatggctttgctgtagtcacacctcctggacatcatgcatcacgttctcaa
acacttgactccattgtttttaattctgtggccattgcagctaaacagcttcaagaacaa
ttaaaggttaaaaagatccttattgtagattgggatgttcatcatggcagtggaactgag
tcgatattctacacagatcccagtgtcctctatatttctctgcatcgctatgatgatggc
gcatttttcaatggtactggagatcccagcagggtaggatgtgatgttggaagaggttat
aatgtaaatgtggcctggtcgggaggactgagacctccaatgggagatgctgaatacctc
gctgcattcagaacggtagtcatgccaattgctcatgagttttccccaaatgtggtcctg
gtttcagctggttttgatgctgccgaggggcatccagctgctctgggaggatacagagtc
tcccctaaatgttttggatggctgacgcagaagttaatggagcttgctgaaggacgagta
gtgctggtgttagagggaggttatgagcttgtctccctttgcgatgcgtcccaagcttgt
gtcagtgctcttctaggaaatgagcctgagcctttatctgaggtggagttactgagaagt
ccctgtgctaatgcagtctgttctctggagaaagtgctgcatgttcagagtttgcactgg
cgttcagtgcggtccatgctgaatactgtgtctctgtcctatgttaaagcagagaggaga
gtctcggcaggcagtgaagctgctttagtgctgagtggcctcaatatgactgttccacac
agaagacaattgcccaatgagccagtggaggacgatgaaacccattcgacagtttccttt
actagaagaaccttttcctttcaaagcagaagctga

DBGET integrated database retrieval system