KEGG   Danio rerio (zebrafish): 792596Help
Entry
792596            CDS       T01004                                 

Definition
histone deacetylase 4-like
Orthology
K11408  
histone deacetylase 7 [EC:3.5.1.98]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 723 aa AA seqDB search
MSHHQQHRTLERGRRSTQEDKLSLRKESEQTGAGCSLSVRRKLYEYICNKQHRTSAGQDI
QQRELDRQEEDNPLRRTASEPILKLRSKRSMTGRQNPLQRKTSAPPAVGDPDSMAVSASS
ATVSSLDNQMNRQELIQTTTYSASSGKEDSPLQISIQHPVLWPAYAATAYNPQVFTLYPH
IFTVTGQQWPPMPHRPLIKSQSAPSYIQQYTHIHTPAYTLVQPMYQQQWPQETFQQHTLP
EKVSVGPAWPESPGDLGRFRKRTSEEVRISSQSPLESCNRQGVQLKENLEWRHKIFHQQV
SRVHSFPDTFDTRLSSHSASALDMRKPNFTTGLVYEMMKHRCDCRDSSCGLHEADRVTSI
WSRLQECGLRSQCKLLKGRSATVEELLSVHSEELVCFFTGPEPYRSQMDIGTMWKNPRNS
EALKMAVGSVTELALCVARGDLRNGFAVVTPPGHHASRSQTLDSIVFNSVAIAAKQLQEQ
LKVKKILIVDWDVHHGSGTESIFYTDPSVLYISLHRYDDGAFFNGTGDPSRVGCDVGRGY
NVNVAWSGGLRPPMGDAEYLAAFRTVVMPIAHEFSPNVVLVSAGFDAAEGHPAALGGYRV
SPKCFGWLTQKLMELAEGRVVLVLEGGYELVSLCDASQACVSALLGNEPEPLSEVELLRS
PCANAVCSLEKVLHVQSLHWRSVRSMLNTVSLSYVKAERRVSAGSEAALVLSGLNMTVPH
RRQ
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaccatcagcagcaccggacactggagagagggaggaggagcacacaagaggac
aaactgtctttgaggaaagagagcgaacaaacaggtgctggctgtagtctctcggtgaga
agaaagctgtatgagtatatctgcaataagcagcacaggacatctgcaggtcaggacata
cagcagcgtgaattagaccgacaggaagaggacaatccactaagaagaacagcctctgag
cctattctgaagctgcgatcaaagagaagtatgacggggagacagaatccattgcagcgt
aaaaccagcgcgccccctgctgtcggggatccagactccatggcggtttctgccagttct
gctacagtttcatcactagataatcaaatgaatcgtcaagagctgattcaaaccacaacc
tacagtgcatcatcaggcaaggaagactctcctttacaaatcagcattcagcaccccgtc
ctctggcctgcatatgctgccactgcttacaatcctcaggtcttcactctttatccacat
atttttacagttactgggcagcagtggccgccgatgcctcatagacctttaatcaaatcc
cagtcagcaccttcttatatacagcaatacacacatatacacactccggcttatacactg
gtacaacccatgtaccaacaacagtggccacaagagacattccagcaacacacccttcca
gaaaaggtttcagttggcccagcatggcctgagtctcctggagatctgggaaggttcaga
aagagaacaagtgaggaagtacgcatttcatctcaatccccgcttgaaagctgtaatcga
cagggagttcagctgaaagaaaacttggaatggagacacaaaatatttcaccagcaggtt
tcacgtgtgcattcctttccagacacctttgacacacgtctgtcttcacattcagcctca
gctctggacatgagaaaaccaaacttcaccacaggcttggtgtatgagatgatgaagcat
aggtgtgactgtagagacagcagctgtggtcttcatgaagctgaccgagttacaagtatc
tggtcaagactgcaggagtgtggcctgaggagtcagtgtaagctgcttaaaggcaggtca
gccactgtcgaggagctactctcagtccattcagaggaacttgtttgttttttcactgga
ccagaaccatatcgaagtcaaatggacattggtacgatgtggaaaaatcccagaaattca
gaggcactgaagatggctgttggtagcgtgacagagctagcgctgtgtgtggccagagga
gacctgaggaatggctttgctgtagtcacacctcctggacatcatgcatcacgttctcaa
acacttgactccattgtttttaattctgtggccattgcagctaaacagcttcaagaacaa
ttaaaggttaaaaagatccttattgtagattgggatgttcatcatggcagtggaactgag
tcgatattctacacagatcccagtgtcctctatatttctctgcatcgctatgatgatggc
gcatttttcaatggtactggagatcccagcagggtaggatgtgatgttggaagaggttat
aatgtaaatgtggcctggtcgggaggactgagacctccaatgggagatgctgaatacctc
gctgcattcagaacggtagtcatgccaattgctcatgagttttccccaaatgtggtcctg
gtttcagctggttttgatgctgccgaggggcatccagctgctctgggaggatacagagtc
tcccctaaatgttttggatggctgacgcagaagttaatggagcttgctgaaggacgagta
gtgctggtgttagagggaggttatgagcttgtctccctttgcgatgcgtcccaagcttgt
gtcagtgctcttctaggaaatgagcctgagcctttatctgaggtggagttactgagaagt
ccctgtgctaatgcagtctgttctctggagaaagtgctgcatgttcagagtttgcactgg
cgttcagtgcggtccatgctgaatactgtgtctctgtcctatgttaaagcagagaggaga
gtctcggcaggcagtgaagctgctttagtgctgagtggcctcaatatgactgttccacac
agaagacagtaa

DBGET integrated database retrieval system