KEGG   Danio rerio (zebrafish): 792708Help
Entry
792708            CDS       T01004                                 

Gene name
chrm1a
Definition
(RefSeq) cholinergic receptor, muscarinic 1a
  KO
K04129  
muscarinic acetylcholine receptor M1
Organism
dre  Danio rerio (zebrafish)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    792708 (chrm1a)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    792708 (chrm1a)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    792708 (chrm1a)
G protein-coupled receptors [BR:dre04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [OT]
    792708 (chrm1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
14
AA seq 442 aa AA seqDB search
MITFITVPLSLITITGNVLVMISFRVNPLLRTVSNYFLLSLAVADVILGSISMNLYTTYI
LLNGWTLGNLACDVWLAVDYVASNASVMNLLAISIDRYLSVMRPLTYRAKRTPKRAMIMI
SLAWTISFVIWAPAILFWQYIVGERTVQENECSIQFLSEPVITFGTAIAAFYLPVSVMVA
LYWRVYRETEKRSQKLAGLMASQGGRTGNASQRSCQSSSRSNEDVRPQTDQQQQQLRNEP
RPVCPSFTHRTAACWKKQREREDISNSYATNNHPQVDFISSRTDHNNKYIPLVGMDKSAA
NKPHDATMNNSDQSESPNSLMNPATTQASALLLNAGQRSRKARTSSLIKEKKAARTLSAI
LLAFIVTWTPYNIMVLVSTFCDNCVPERLWKLGYWLCYVNSTVNPLCYALCNKHFRVTFR
ALLLCRWKEHKKGIRWTPNGNA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccttcataactgttcccctgtccctcatcaccatcacaggtaacgtcctggtc
atgatctcctttcgggtcaacccactcctgaggacagtaagcaactactttctcttaagc
ttggcggtggctgatgtaattttgggctccatctcgatgaacctctatactacatacatc
ttgcttaatgggtggactttaggcaatcttgcctgtgatgtgtggttggctgtggactat
gtggcaagcaacgcctctgttatgaacctgctggccatcagtattgaccgctacctttct
gtcatgcgacctctgacctatcgagctaaaagaacacccaaaagagccatgataatgatt
tctctagcgtggaccatctcgtttgtgatttgggctccagcaattttgttttggcagtat
atagttggggaacggactgttcaggaaaatgagtgttcaatacagtttctgtcagagcct
gtgatcacctttggaacagccatcgctgcattttacctgccagtaagtgtgatggtggca
ttgtactggcgtgtgtatcgtgagacagagaagcgctctcagaagctggctggactgatg
gcgtcacagggaggacgaactggaaatgcatctcagagatcatgtcagagcagttctcgc
agtaatgaagatgtcagaccacaaacagaccagcagcagcagcagctcagaaatgaacca
aggcctgtctgtccaagcttcacccatcgaacagcagcctgttggaagaaacaaagggaa
agggaagacatttccaactcatacgctacaaacaaccatccacaagtggactttatttct
tcaagaacagaccataataacaaatacatcccgctagttggaatggataagtctgcggcc
aataaacctcacgatgccaccatgaacaacagcgatcagtcagaaagtccgaattccctt
atgaatcctgcaaccacacaagcttctgctctattactgaacgcaggtcagaggagcaga
aaagcccgcacttcatcactgatcaaggagaagaaagcagcccggaccctcagtgccatt
cttctggctttcattgtaacatggacaccatataacatcatggttctggtatccacgttc
tgcgacaattgtgttcctgagagactttggaaactgggatactggctctgctatgttaac
agcacagtcaatccgctctgctacgcgctctgtaacaaacacttccgtgtcacatttagg
gcactgctgctctgtaggtggaaggaacataagaagggaataaggtggaccccgaatgga
aatgcctga

DBGET integrated database retrieval system