KEGG   Danio rerio (zebrafish): 792708Help
Entry
792708            CDS       T01004                                 

Definition
muscarinic acetylcholine receptor M3-like
Orthology
K04129  
muscarinic acetylcholine receptor M1
Organism
dre  Danio rerio (zebrafish)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    792708
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    792708
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    792708
G protein-coupled receptors [BR:dre04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [OT]
    792708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 442 aa AA seqDB search
MITFITVPLSLITITGNVLVMISFRVNPLLRTVSNYFLLSLAVADVILGSISMNLYTTYI
LLNGWTLGNLACDVWLAVDYVASNASVMNLLAISIDRYLSVMRPLTYRAKRTPKRAMIMI
SLAWTISFVIWAPAILFWQYIVGERTVQENECSIQFLSEPVITFGTAIAAFYLPVSVMVA
LYWRVYRETEKRSQKLAGLMASQGGRTGNASQRSCQSSSRSNEDVRPQTDQQQQQLRNEP
RPVCPSFTHRTAACWKKQREREDISNSYATNNHPQVDFISSRTDHNNKYIPLVGMDKSAA
NKPHDATMNNSDQSESPNSLMNPATTQASALLLNAGQRSRKARTSSLIKEKKAARTLSAI
LLAFIVTWTPYNIMVLVSTFCDNCVPERLWKLGYWLCYVNSTVNPLCYALCNKHFRVTFR
ALLLCRWKEHKKGIRWTPNGNA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccttcataactgttcccctgtccctcatcaccatcacaggtaacgtcctggtc
atgatctcctttcgggtcaacccactcctgaggacagtaagcaactactttctcttaagc
ttggcggtggctgatgtaattttgggctccatctcgatgaacctctatactacatacatc
ttgcttaatgggtggactttaggcaatcttgcctgtgatgtgtggttggctgtggactat
gtggcaagcaacgcctctgttatgaacctgctggccatcagtattgaccgctacctttct
gtcatgcgacctctgacctatcgagctaaaagaacacccaaaagagccatgataatgatt
tctctagcgtggaccatctcgtttgtgatttgggctccagcaattttgttttggcagtat
atagttggggaacggactgttcaggaaaatgagtgttcaatacagtttctgtcagagcct
gtgatcacctttggaacagccatcgctgcattttacctgccagtaagtgtgatggtggca
ttgtactggcgtgtgtatcgtgagacagagaagcgctctcagaagctggctggactgatg
gcgtcacagggaggacgaactggaaatgcatctcagagatcatgtcagagcagttctcgc
agtaatgaagatgtcagaccacaaacagaccagcagcagcagcagctcagaaatgaacca
aggcctgtctgtccaagcttcacccatcgaacagcagcctgttggaagaaacaaagggaa
agggaagacatttccaactcatacgctacaaacaaccatccacaagtggactttatttct
tcaagaacagaccataataacaaatacatcccgctagttggaatggataagtctgcggcc
aataaacctcacgatgccaccatgaacaacagcgatcagtcagaaagtccgaattccctt
atgaatcctgcaaccacacaagcttctgctctattactgaacgcaggtcagaggagcaga
aaagcccgcacttcatcactgatcaaggagaagaaagcagcccggaccctcagtgccatt
cttctggctttcattgtaacatggacaccatataacatcatggttctggtatccacgttc
tgcgacaattgtgttcctgagagactttggaaactgggatactggctctgctatgttaac
agcacagtcaatccgctctgctacgcgctctgtaacaaacacttccgtgtcacatttagg
gcactgctgctctgtaggtggaaggaacataagaagggaataaggtggaccccgaatgga
aatgcctga

DBGET integrated database retrieval system