KEGG   Danio rerio (zebrafish): 793249Help
Entry
793249            CDS       T01004                                 

Gene name
cyp21a2
Definition
(RefSeq) steroid 21-hydroxylase-like
  KO
K00513  
steroid 21-monooxygenase [EC:1.14.14.16]
Organism
dre  Danio rerio (zebrafish)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    793249 (cyp21a2)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     793249 (cyp21a2)
Cytochrome P450 [BR:dre00199]
 Cytochrome P450, animal type
  CYP21 family
   793249 (cyp21a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
Position
16
AA seq 522 aa AA seqDB search
MCFSVVSVVLLLFILWMLVVKFRRQSHRRTDGVAKENNKPEAVFPKLLHSLYKLFFSTVS
PTISGPRSLPLLGNMLDLAQDHLPIHLTALAKCYGNIYRLNCGSTTMVVLNNSEIIREAL
VKKWSDFAGRPHSYTGDIVSRGGRTISLGDFSEEWKAHRRVTHSALQRCTTDSLHSVIEK
QAQHLCQVLRDYSGKAVDLSEDFTVASSNVITTLTFSKAYDKSSAELQKLQECLNEIVSL
WGSPWISALDSFPLLRKFPNPPFSRLMKEVARRDELIGKHIEEFKKSEHKEGGTLTSSLL
KCLEPQQGAANHTTLTDTHVHMTTVDLLIGGTETIAALLNWTVAFLLHRPEVQDKVYEEL
CCMLDVRHPQYSDRHKLPYLCALISEMLRLRPVAPLAVPHRAIRNSSIAGHFIPKNTIII
PNLYGAHHDPEVWDDPYSFKPERFLEGGGGSLRSLIPFGGGARLCLGEAVAKMEMFLFTA
YLLREFKFLPASKEEPLPELRGVASVVLKVKPYTVIAHPREQ
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtgtttctctgtggtcagtgttgtgctattgctgttcattttgtggatgcttgtggtc
aagtttaggagacagagccacagacgaactgatggcgttgccaaagaaaacaacaaacca
gaagctgtttttcccaaactcctgcattcactctataagctcttcttcagtaccgtttct
ccaactatttctggtcctcgctctctccctttgctgggaaacatgctggatctcgcccaa
gatcatctgcccatccacttgactgcattggcaaaatgctatggaaatatttatcggctt
aactgtggcagcacaactatggttgttttaaacaacagtgagattatccgtgaggctcta
gttaagaaatggtctgactttgctgggaggcctcattcatacaccggtgatatagtgtct
agaggaggacgaaccatttctttgggtgatttcagtgaggaatggaaagctcatagacgt
gtcacccacagtgctctgcagcgctgcaccactgactccctgcactctgtcatagaaaag
caagcacaacatctctgtcaggtgttacgagactacagtggaaaggctgtggatttatcg
gaggactttactgtggcttcgagtaatgtcatcacaactctgaccttcagcaaagcttat
gataaaagttcagcagagctgcagaagctgcaggagtgtttgaatgagattgtttctctc
tggggttcaccctggatctcagccctggactccttccctctgctcaggaaatttcccaac
cccccattctctcgtctaatgaaggaggtggccagacgcgatgagctgataggaaaacac
atagaggagtttaagaaaagtgagcataaagaaggtggcacactgacttcttcactcctg
aagtgtcttgaaccacaacaaggggcagccaatcacacgactctgacagacactcatgtg
catatgaccacggtggatctgctgattggagggacagaaactattgctgccttgcttaac
tggactgtggccttccttttacacaggccagaggttcaggataaagtgtatgaggagctg
tgctgtatgctggatgtgcggcaccctcagtacagtgaccgacacaaactgccatatctg
tgtgctctgatcagtgagatgttacgactgcgacctgtagctcccctcgccgtaccacac
agagccatacgaaacagcagcattgcagggcatttcattcccaagaatacaattatcatc
cctaatctttacggagctcaccatgatccagaagtctgggatgatccatatagcttcaaa
ccagaacgctttttggaaggtggtggcgggtcccttcgttctctgataccttttggagga
ggcgcacgactgtgtttgggagaggcggtagccaaaatggagatgtttctcttcacggca
tatctcctgcgagagttcaagttcctgcctgccagtaaagaagagccactgcctgaactg
cgaggtgtcgccagcgtggttcttaaagttaaaccatatacagttatagcacaccccaga
gaacagtag

DBGET integrated database retrieval system