KEGG   Danio rerio (zebrafish): 79380Help
Entry
79380             CDS       T01004                                 

Gene name
eif4ea, eif4e, eif4e-1, eif4e1a, zgc:86680
Definition
eukaryotic translation initiation factor 4ea
Orthology
K03259  
translation initiation factor 4E
Organism
dre  Danio rerio (zebrafish)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    79380 (eif4ea)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    79380 (eif4ea)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    79380 (eif4ea)
Translation factors [BR:dre03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    79380 (eif4ea)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
14
AA seq 215 aa AA seqDB search
MATAEPETSTNPSNSEEKNEENEQQIVSLEDYIKHPLQNRWALWFFKNDKSKTWQANLRL
ISKFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDERNKRGGRWLITLSKQQR
RADLDRFWLETLLCLVGEAFDDHSDDVCGAVVNIRTKGDKIAIWTTDYENKDAIVHIGRV
YKERLGVPPKVIIGYQSHADTATKSGSTTKNKFVV
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgctgaaccggaaacttcaacaaatccatcaaattcagaagaaaaaaatgag
gaaaatgagcaacagatcgtgagtcttgaagattacattaaacatccactgcagaacaga
tgggctctttggttctttaaaaatgacaaaagcaaaacatggcaagctaatctccgtctc
atctcaaagtttgacaccgtggaggacttctgggcgttatacaatcacattcagttatca
agtaacttaatgtcaggatgtgattactcccttttcaaggatggcattgagcccatgtgg
gaagatgagagaaacaagcggggtggccgctggctgatcaccctctccaaacagcagcgc
agagctgacctggaccgcttctggctggaaacacttttgtgccttgttggagaagcgttt
gatgaccacagtgatgatgtctgtggtgctgtcgttaacatccgaacaaagggagacaaa
atcgcaatatggacgacagactacgagaacaaagatgccatcgtacacatagggcgtgtg
tacaaagaaagattaggtgtgccaccaaaggtcatcattggataccagtcacatgcggac
acggccaccaaaagtggttccaccaccaagaacaagtttgttgtttaa

DBGET integrated database retrieval system