KEGG   Danio rerio (zebrafish): 793834Help
Entry
793834            CDS       T01004                                 

Gene name
hadhab, im:7144234, zgc:158138
Definition
hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase, alpha subunit b
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
dre  Danio rerio (zebrafish)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:dre01200]
Metabolism; Overview; Fatty acid metabolism [PATH:dre01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dre00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:dre00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:dre00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:dre00071]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dre01040]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:dre00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:dre00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:dre00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:dre00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
17
AA seq 763 aa AA seqDB search
MAGVRALGSLSRLTTRRYTLFPGVTRRTFKFAACMMARTHVSYEVKGDVAVVRMNDPTAK
VNTLSVQMQKDMTEVMDEVWGNSAVQSVVLISSKPGCFIAGADISMIKACKTAEEVTGLS
QEGQRMFEKIEKSPKPIVAAINGSCLGGGLEFAIACQYRIATKSKKTVLGCPEVMLGLLP
GAGGTQRLPKMLGLPSAFDVMLTGRSIRADKAKKMGLVHQLVDTLGPGLKSPEERTIEYL
EEVAVEAARGLAQKKITLTKEKGWMQKIQDYVMSYPFVRQQIYNTVEKKVMKQTKGLYPA
PLKIIESVKAGVEQGPTTGYLVESQQFGKLAMTNESKALIGLYHGQVACKKNRFGTPEKE
VKTLAILGAGLMGAGIAQVTVDKGIHTILKDTTVDGLSRGEQQVFKGLNDKTKKKSLTSF
ERDTFLSNLTGQLDYNGFNKADMIIEAVFEDLSIKHKVLKEVEAVIPPHCIFATNTSALP
IKDIAAVSKRPDKVVGMHYFSPVDKMQLLEIITTDKTSKDTTASAVAVGLKQGKVIIVVG
DGPGFYTTRCLAPMLAEAVRILQEGTDPKKLDSLTTGFGFPVGAATLADEVGIDVAAHVA
EDLGKAFGSRFGGGNVEFLKSMVEKGFKGRKSGKGCYVYQPGLKRRDVNTEALEILEAYK
LTPNAAISSDSDIQYRLVSRFVNEAVLCLQEGILANPVEGDIGAVFGLGFPPCLGGPFRF
VDSFGADKLVEKMRRFEEVFGNQFTPCQLLLDHARDPSKKFHK
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgtacgagccctcggttccctctccagactcacaaccagaagatataccctg
tttccaggtgtcaccaggcggacctttaaatttgctgcttgcatgatggctcgtacacat
gtgagctatgaggtcaagggagatgtggctgtggtccgcatgaatgaccccaccgcaaag
gtaaacacactctctgttcaaatgcaaaaggatatgacagaagttatggatgaggtttgg
gggaacagtgctgtccagagtgttgttctcatctcatccaaacccggctgcttcattgca
ggagcagatatcagcatgattaaggcctgcaagaccgcagaggaggtcactggtctttct
caagagggccagaggatgtttgagaagatcgagaagtctcctaagccaattgttgctgcc
attaatggatcgtgccttggtggaggattagagtttgccattgcctgtcagtacagaata
gccaccaagagtaagaagacggttctaggctgtccagaggtcatgctcggcctgctgcct
ggagctggaggaacacagagactccccaaaatgcttggtcttcccagtgcctttgatgta
atgctgacaggacggagtatccgtgcagataaagccaagaaaatgggcctggttcatcag
ctggtggatactctcgggcctggattaaagagtccagaggagaggaccattgaatacttg
gaagaagttgctgtggaggctgcaagaggacttgctcagaagaaaatcacactcaccaaa
gaaaaaggctggatgcagaaaatccaggattacgtcatgagttatccatttgtgagacaa
cagatctacaacacagttgagaagaaagtcatgaagcagactaagggactgtatcctgct
cctctgaaaataattgagagtgtgaaggctggtgtagagcagggtccgaccacaggttac
ctggttgagtcacagcaatttggcaagttagcaatgaccaatgagagtaaagcacttatt
ggtctttatcacggtcaagtggcatgcaagaagaatcgatttggaacccctgagaaagaa
gtaaaaacgcttgctatcttgggagcggggctgatgggtgctggcattgctcaagtgaca
gtagataaaggcattcacaccattcttaaggacacaacagtggatggactcagtcgagga
gagcagcaggtctttaaagggcttaatgacaaaacaaagaagaagagcctaacatcattt
gaaagggacacttttctgtccaacctaacgggccagctagactacaatggctttaataaa
gccgatatgatcattgaagccgtttttgaggacctgagcatcaaacacaaagtcctaaaa
gaagtcgaagcagtgattcccccacattgcatatttgctaccaacacatctgctttacca
atcaaagatattgcagccgtgagcaagcgacctgataaggttgtcggaatgcactacttt
tctccagtggacaagatgcagctgctggagatcatcaccactgataaaacctccaaggac
acaacggcctcagcagtggcggtcggcctgaagcagggcaaagtcatcattgttgttggg
gatggaccaggattctacaccaccagatgtttagctcccatgttggcagaggcagtgcgt
atattgcaggaaggcactgatcctaagaaactggattccctgaccacaggctttggcttc
cctgttggcgcagctactttggctgatgaagtgggcattgatgtagcagctcatgtggct
gaagacctcggcaaggctttcggctccagatttggagggggaaatgttgagtttttgaag
tctatggtggagaaaggattcaaaggccgtaaatcaggcaaaggctgctatgtttaccag
cctgggctcaaacgcagagacgtgaacactgaagctctggagattctggaagcatacaag
ctgaccccaaacgctgcaatatcttcggactcagatattcagtaccggttggtgtcccgt
tttgtgaatgaagccgttctgtgtctgcaagagggaatccttgccaatccggtggaaggt
gacattggtgccgttttcggtctcggctttccaccctgccttggaggccccttcaggttt
gtggacagctttggtgcagacaaactggtggagaagatgcggaggtttgaggaggttttc
gggaaccagtttaccccttgtcagctgctgctggatcatgccagggatccaagcaagaag
tttcataagtga

DBGET integrated database retrieval system