KEGG   Danio rerio (zebrafish): 793949Help
Entry
793949            CDS       T01004                                 

Gene name
tmsb4x
Definition
(RefSeq) thymosin beta-4
  KO
K05764  thymosin, beta 4
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    793949 (tmsb4x)
Cytoskeleton proteins [BR:dre04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Thymosin
     793949 (tmsb4x)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thymosin DUF4522
Motif
Other DBs
NCBI-GeneID: 793949
NCBI-ProteinID: NP_001124169
ZFIN: ZDB-GENE-030131-8304
Ensembl: ENSDARG00000077777
UniProt: Q45QT2
Position
9
AA seq 44 aa AA seqDB search
MSDKPNLEEVTSFDKTKLKKTETQEKNPLPSKETIEQEKQAGSS
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaagccaaatctcgaggaggtgaccagctttgacaagaccaagctgaagaaa
acagaaactcaggagaaaaatcccctgccatcaaaagaaaccatcgaacaggagaagcag
gcgggttcatcatga

DBGET integrated database retrieval system