KEGG   Danio rerio (zebrafish): 793949Help
Entry
793949            CDS       T01004                                 

Gene name
tmsb4x, Tbeta11, fb08c07, wu:fb08c07, wu:fj40h03, zgc:195154
Definition
thymosin, beta 4 x
Orthology
K05764  
thymosin, beta 4
Organism
dre  Danio rerio (zebrafish)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    793949 (tmsb4x)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
9
AA seq 44 aa AA seqDB search
MSDKPNLEEVTSFDKTKLKKTETQEKNPLPSKETIEQEKQAGSS
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaagccaaatctcgaggaggtgaccagctttgacaagaccaagctgaagaaa
acagaaactcaggagaaaaatcccctgccatcaaaagaaaccatcgaacaggagaagcag
gcgggttcatcatga

DBGET integrated database retrieval system