KEGG   Danio rerio (zebrafish): 795517Help
Entry
795517            CDS       T01004                                 

Gene name
mos, c-mos
Definition
v-mos Moloney murine sarcoma viral oncogene homolog (EC:2.7.11.1)
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:dre04010]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:dre04810]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:dre04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:dre04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
15
AA seq 329 aa AA seqDB search
MPSPIPVTRLLPKDFGLEFGACSSPLTKTASGSTLRVPTNKFHGKVAHRLWSSVIHWREL
QALEPIGSGGFGTVFRGTYFGETVAVKKVKCVKNKLASRQSFWAELNAAHLHHQNIVRVL
AATTCTPAHLNTKDNIGTIVMEFAGNINLQKLIYGLTDLLPVEKCIKYSIDIARALQHLH
AHGVVHLDLKPANVLLSEQGVCKIADFGCSFKISSTSDTVTHMNEIGGTFTHRAPELLKG
EEVSPRVDVYSFGITLWQLLTREPPYEGDRQYILYAVVGYNLRPLTSRNVFTQFFIGQNC
QKLISRCWDGDPSIRPTADKFVDELSVLL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgccctcaccaatccccgtcacccgacttttgccaaaggatttcggcctcgagtttggc
gcatgcagcagcccgctgaccaaaactgccagtggatctaccctgcgcgtgcccacaaac
aagtttcatggtaaagtcgcacacaggctctggtcctccgtgatccactggcgcgagctg
caggctctggagcccataggcagcggtggattcggtacggtgttcagaggcacatacttc
ggcgagactgtcgctgtgaaaaaggtcaagtgtgtgaaaaacaaactggcatcgaggcaa
agtttctgggcggaactcaacgccgcgcacctgcaccatcaaaacattgtgcgcgtgctc
gcggccaccacgtgcactcctgcgcatctcaacaccaaagacaacatcgggacgatcgta
atggagttcgcaggcaatataaatctacagaagctcatttatgggctcacagacttgctt
cctgtggagaagtgtataaagtattcaatagacatcgcgcgcgccctccagcacctgcac
gcgcacggcgtagtgcacctggatttaaaaccagccaatgtcttgttgtcagaacagggt
gtttgtaaaatcgcagattttgggtgctcgtttaaaatatccagcacaagtgacaccgtg
acgcacatgaatgaaatcggcggcacgtttacgcaccgggcgcccgagctgctgaaaggt
gaggaagtgtcgccgcgcgtggacgtttattcttttggcataacgttgtggcagctgctc
acccgagagccgccctatgagggagacagacagtatatcctgtacgctgttgtggggtat
aacctgcgccctttgaccagcaggaatgtttttacccagttttttattggacagaattgt
caaaaactgatcagccggtgttgggacggcgaccccagcatccgaccgaccgcagataag
tttgtcgacgaactttcagttttactgtaa

DBGET integrated database retrieval system