KEGG   Danio rerio (zebrafish): 795517Help
Entry
795517            CDS       T01004                                 

Gene name
mos
Definition
(RefSeq) proto-oncogene serine/threonine-protein kinase mos
  KO
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    795517 (mos)
  Cell motility
   04810 Regulation of actin cytoskeleton
    795517 (mos)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    795517 (mos)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     795517 (mos)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: Other group
  MOS family
   795517 (mos)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
15
AA seq 329 aa AA seqDB search
MPSPIPVTRLLPKDFGLEFGACSSPLTKTASGSTLRVPTNKFHGKVAHRLWSSVIHWREL
QALEPIGSGGFGTVFRGTYFGETVAVKKVKCVKNKLASRQSFWAELNAAHLHHQNIVRVL
AATTCTPAHLNTKDNIGTIVMEFAGNINLQKLIYGLTDLLPVEKCIKYSIDIARALQHLH
AHGVVHLDLKPANVLLSEQGVCKIADFGCSFKISSTSDTVTHMNEIGGTFTHRAPELLKG
EEVSPRVDVYSFGITLWQLLTREPPYEGDRQYILYAVVGYNLRPLTSRNVFTQFFIGQNC
QKLISRCWDGDPSIRPTADKFVDELSVLL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgccctcaccaatccccgtcacccgacttttgccaaaggatttcggcctcgagtttggc
gcatgcagcagcccgctgaccaaaactgccagtggatctaccctgcgcgtgcccacaaac
aagtttcatggtaaagtcgcacacaggctctggtcctccgtgatccactggcgcgagctg
caggctctggagcccataggcagcggtggattcggtacggtgttcagaggcacatacttc
ggcgagactgtcgctgtgaaaaaggtcaagtgtgtgaaaaacaaactggcatcgaggcaa
agtttctgggcggaactcaacgccgcgcacctgcaccatcaaaacattgtgcgcgtgctc
gcggccaccacgtgcactcctgcgcatctcaacaccaaagacaacatcgggacgatcgta
atggagttcgcaggcaatataaatctacagaagctcatttatgggctcacagacttgctt
cctgtggagaagtgtataaagtattcaatagacatcgcgcgcgccctccagcacctgcac
gcgcacggcgtagtgcacctggatttaaaaccagccaatgtcttgttgtcagaacagggt
gtttgtaaaatcgcagattttgggtgctcgtttaaaatatccagcacaagtgacaccgtg
acgcacatgaatgaaatcggcggcacgtttacgcaccgggcgcccgagctgctgaaaggt
gaggaagtgtcgccgcgcgtggacgtttattcttttggcataacgttgtggcagctgctc
acccgagagccgccctatgagggagacagacagtatatcctgtacgctgttgtggggtat
aacctgcgccctttgaccagcaggaatgtttttacccagttttttattggacagaattgt
caaaaactgatcagccggtgttgggacggcgaccccagcatccgaccgaccgcagataag
tttgtcgacgaactttcagttttactgtaa

DBGET integrated database retrieval system