KEGG   Danio rerio (zebrafish): 795517Help
Entry
795517            CDS       T01004                                 

Gene name
mos, c-mos
Definition
v-mos Moloney murine sarcoma viral oncogene homolog (EC:2.7.11.1)
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    795517 (mos)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    795517 (mos)
  Cell growth and death
   04114 Oocyte meiosis
    795517 (mos)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    795517 (mos)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     795517 (mos)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: Other group
  MOS family
   795517 (mos)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
15
AA seq 329 aa AA seqDB search
MPSPIPVTRLLPKDFGLEFGACSSPLTKTASGSTLRVPTNKFHGKVAHRLWSSVIHWREL
QALEPIGSGGFGTVFRGTYFGETVAVKKVKCVKNKLASRQSFWAELNAAHLHHQNIVRVL
AATTCTPAHLNTKDNIGTIVMEFAGNINLQKLIYGLTDLLPVEKCIKYSIDIARALQHLH
AHGVVHLDLKPANVLLSEQGVCKIADFGCSFKISSTSDTVTHMNEIGGTFTHRAPELLKG
EEVSPRVDVYSFGITLWQLLTREPPYEGDRQYILYAVVGYNLRPLTSRNVFTQFFIGQNC
QKLISRCWDGDPSIRPTADKFVDELSVLL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgccctcaccaatccccgtcacccgacttttgccaaaggatttcggcctcgagtttggc
gcatgcagcagcccgctgaccaaaactgccagtggatctaccctgcgcgtgcccacaaac
aagtttcatggtaaagtcgcacacaggctctggtcctccgtgatccactggcgcgagctg
caggctctggagcccataggcagcggtggattcggtacggtgttcagaggcacatacttc
ggcgagactgtcgctgtgaaaaaggtcaagtgtgtgaaaaacaaactggcatcgaggcaa
agtttctgggcggaactcaacgccgcgcacctgcaccatcaaaacattgtgcgcgtgctc
gcggccaccacgtgcactcctgcgcatctcaacaccaaagacaacatcgggacgatcgta
atggagttcgcaggcaatataaatctacagaagctcatttatgggctcacagacttgctt
cctgtggagaagtgtataaagtattcaatagacatcgcgcgcgccctccagcacctgcac
gcgcacggcgtagtgcacctggatttaaaaccagccaatgtcttgttgtcagaacagggt
gtttgtaaaatcgcagattttgggtgctcgtttaaaatatccagcacaagtgacaccgtg
acgcacatgaatgaaatcggcggcacgtttacgcaccgggcgcccgagctgctgaaaggt
gaggaagtgtcgccgcgcgtggacgtttattcttttggcataacgttgtggcagctgctc
acccgagagccgccctatgagggagacagacagtatatcctgtacgctgttgtggggtat
aacctgcgccctttgaccagcaggaatgtttttacccagttttttattggacagaattgt
caaaaactgatcagccggtgttgggacggcgaccccagcatccgaccgaccgcagataag
tttgtcgacgaactttcagttttactgtaa

DBGET integrated database retrieval system