KEGG   Danio rerio (zebrafish): 795752Help
Entry
795752            CDS       T01004                                 

Gene name
arhgap5
Definition
Rho GTPase activating protein 5
Orthology
K13709  
Rho GTPase-activating protein 5
Organism
dre  Danio rerio (zebrafish)
Pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    795752 (arhgap5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
17
AA seq 1502 aa AA seqDB search
MAKNKETRPTYAVSVVGLSGTEKEKGNCGVGKSCLCNRYVRPSADCYYLEHTSVLSTIDF
GGRVVNNDHFLYWGEVLHRGDDGVECRIQVIEQTEFIDDQTFLPHRSTNLQPYTKRAANT
KLQSAEKLMYICTDQLGLEQDFDQKQMPDGKLNIDGFVLCIDISKGCNRKFDDQMKFVHS
LYSQISKAKKPIIIAATKCDECVEQYLREVQTFVTGKKNLMLVETSARASVNVELCFNAL
TQQIDKTRGKPKIISYLEAYKSQRQLVASVSDKFEKLIVQTVRDYHTSWKIVSNKLKSHP
DYEEYINLEGTKKARNTFSKHIEQLRQEHIKRRREDYLTSLPKIFNKLLNNLEEIETMSW
TEAQSLMRSRHEFQYCFIELEHTPWYETDHLDKTDDRRVPFDILQTMQGERIYQNHVQHL
ISEKRRLEMKEKFKKTLERVHFISPGQPWEEVMCFVMEDEAYKYITESDRRDVYSRHQQE
IVERAKEEFQEMLFEHAELFYDLDLNATPSYDKMSEIHAVLNEEPRYRALQKLATDRESL
LLKHIGFVYHPTKETCLSGTACIDLKVEQVLANRLVQLDHGRSNIYYNSANIEKVNLCLV
GREGLAQELANEIRAQSTDDEYTLDGKIYELDLLPVDVNSGMLLNHSWISTFKPHGFFCV
FSSIESLNYIGDRVSRIRAEIAQSRRDRYSQPVPFILILANQRDSVCKNMPILRHQGQQL
ANKLQCTFVDIPTGTFPRKFNESQIKQALRAVLEGLKHNFDMMSPMPSIKDLSETDLRIV
MCAMCGDPFSVDLILSPFLDSHSCSAGQPGQCNTLILDKIIGNGRRRIQVTVLSYHSSIG
IRKDELVHGYILVYSAKRKSSMAMLRAFLAEVQDVIPVQLVAITDSQADFFENEAIKELM
TEGEHIATEIAAKFTALYSLSQYHRQTEVFTPFFNEVLEKKSNIESSFMFDNSRDGTGTT
EDVFPQSPHSHSPAYQYYPDSEDDGEGPPPYSPIGDDVQLLPNPSERKYRIDLEGNEYPI
HSTPVGEHERNHKVPPPVKPKPNVLPKPNVKKLDPNLLRTIEAGMRTSRWTRGPMMGHSD
DLEASDNYAEPADTLQHKSKGYSDDIYAVPEDAHSRSGKTRNSFGGLVVHVDEENGFDSM
SKSQGGRRPSKYKHRSKILFSKTKAYHRRVHSDVSDDESGPATQKKKKGRGNRGSEEDPL
LSPVDPWKGGIDNPAITSDPEQDERKTKKKKAPKTKEPKKPTRSTKTTKPLYPPTRRNWE
SNYFGVPLQNLVTPDRPIPLFVEKCVDYIERTGFTTEGLYRVCGNKTDQDNIQKQFDQDH
SIDLIVMDVAVNAVAGALKAFFADLPDPLIPYSLHPELVEAAKIVDHYERLQVLKEIVRK
FPPVNYEVFKYVITHLNRVSQHSKTTLMTADNLSICFWPTLMRPDFENKDTLSTTKLNQS
VIESFIQQCQYFFYGGDMTEPSSAEGTPPPHGHGLESLLALQLPPPLQPQQIQHPLPPEP
LI
NT seq 4509 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaataaggagacccgtccgacatatgctgtcagtgtcgtcgggctctcaggc
actgaaaaggaaaaaggtaactgtggtgtaggtaaatcctgcctatgcaacagatatgtg
cgccccagcgcggactgctactacttagagcacacttctgtgttgagcacaattgacttt
ggagggcgtgtagtgaataatgatcacttcttgtactggggtgaagtgttgcatcgaggg
gatgatggtgtcgagtgtaggattcaggtcatcgagcagacagagttcattgatgatcag
accttcttgcctcatcggagcacaaacttgcagccttacacaaaacgggcggcgaatacg
aagcttcagtctgctgagaagctgatgtacatttgcacagaccaacttgggttggaacag
gattttgatcagaagcagatgcccgatggcaagcttaacattgatggctttgtattgtgt
atagacataagcaaaggatgcaatagaaaatttgacgatcagatgaaatttgtccacagt
ctttattctcaaatttccaaggctaaaaagcctattatcattgctgcaacaaaatgtgac
gagtgtgttgagcaatacctaagggaggtccagacgtttgttacaggtaagaagaatcta
atgttggtggaaacatctgcacgagcatctgtgaatgtggaactctgtttcaatgctctg
acacagcaaatagacaaaaccagaggtaaacccaaaatcatctcttatttggaagcgtac
aaatcccagagacaattagtagcttcagtctcagacaagtttgaaaagctcatcgttcaa
actgtccgagattatcacacaagctggaaaattgtgagcaataagttaaaaagccaccca
gattatgaggagtacatcaatttagaaggcaccaaaaaggcccgaaacactttttcaaag
cacatagagcagctgagacaagagcatatcaagaggcggcgtgaggattatcttaccagc
ctgccaaaaatttttaataagttgcttaacaacctggaggaaattgagacgatgagttgg
actgaggctcagagccttatgaggagcaggcatgaatttcaatactgtttcattgagtta
gagcacacgccgtggtatgagacagaccaccttgataaaaccgacgacagaagagtgccc
ttcgatatcctccaaaccatgcaaggagagaggatttatcaaaaccatgtccagcatttg
atatctgagaagaggcggctggagatgaaggagaaatttaagaagacgctggagcgagtg
catttcattagccctggccaaccgtgggaagaggtcatgtgctttgtcatggaggatgag
gcgtacaagtacatcactgaatcagatcgcagagatgtttacagtcggcatcagcaggaa
atagttgaaagggccaaagaggagtttcaggaaatgctttttgaacacgcagagctgttc
tatgacctcgatctaaatgcaaccccgagctatgacaaaatgagcgagattcatgccgta
cttaatgaggagccaagatacagggctctccaaaaactagccacagacagggagtccctt
ttgctgaaacacattgggtttgtctatcaccccacaaaagaaacatgcctcagtggcacg
gcctgcatcgatctcaaagtagagcaagtcctggccaaccgtctagttcagctggatcac
ggccgctcaaatatctactacaacagtgccaacattgagaaggttaacttatgtcttgtg
ggtagagaaggactggcacaggagcttgcaaatgaaatccgagctcagtccactgatgat
gaatacactcttgatgggaaaatatatgaattagaccttttgcctgtggatgtcaattcc
ggcatgcttttgaaccattcctggatatcgactttcaagccccatgggttcttttgtgtc
ttcagctctatagagtcgcttaattacattggtgaccgcgtaagccggatccgagcagag
attgcccagagcagaagggataggtatagccagccagtgccattcattctcattctagca
aatcagcgtgacagtgtttgcaaaaacatgcctattttgaggcatcagggccaacagctt
gcaaataagctacagtgtacttttgtagatatacccaccggcacttttcccaggaagttt
aatgagtctcagataaaacaggccctcagagctgtgctggagggattgaagcacaatttc
gacatgatgagccccatgccctccatcaaggatctgtctgagacggatttgcggattgtc
atgtgtgccatgtgtggagacccgttcagcgtggatctcattctctcaccattcctggac
tcccattcctgtagtgccggacagcccgggcagtgcaacacattgatccttgacaaaatc
atcggcaacggccgcaggcgcatacaggtcacggtgctctcttaccactcctccattgga
atcagaaaggatgaattggtgcatgggtacattctagtttactcagcaaaaagaaagtct
tccatggctatgctgagggcgttcctggcggaagtccaggatgtcattccagttcagctg
gtggccattacggacagccaagcagacttttttgagaatgaggcgataaaagaactgatg
actgaaggggagcacattgccactgaaattgctgctaagtttacagctctctactccttg
tcccagtatcacaggcagactgaagttttcacaccgttttttaatgaggttcttgagaag
aagagcaacatagaaagctccttcatgttcgacaacagcagggacggaactggcaccacc
gaagatgtcttcccgcagtcaccccatagccattcgcccgcttaccaatactaccctgac
tctgaggatgatggagaggggccaccaccctacagcccgataggagatgatgtgcagctc
ctgcccaatcctagtgaacggaaatacaggattgaccttgaaggaaatgagtacccaatt
cacagcacacctgttggagaacacgagcgtaaccacaaagtgcctcccccggtaaaaccc
aagcccaatgtgctgcccaaacccaatgttaagaagctggaccccaaccttctgaggacc
atcgaggctggaatgaggacctccaggtggacacgaggtccaatgatgggtcacagtgat
gaccttgaagcatctgacaactatgcagagccagcagacactctccaacacaaatcaaaa
ggctacagcgatgatatttatgctgtaccagaagatgcacacagcagatctggcaagacc
cgcaactctttcggcggactagttgtgcatgtggatgaggagaacggctttgattccatg
tctaagtctcagggtggcagaaggccttctaagtataaacatcgttccaagatcctcttc
agcaagacaaaagcttatcatagacgagtgcactctgatgtcagtgatgatgagtcgggg
cctgccacacagaagaagaagaaaggaaggggcaaccgaggcagtgaagaagacccgctt
ctctcaccagtggatccttggaaaggagggatagataatccagccatcacatcggaccca
gagcaggatgaaaggaaaacgaagaaaaagaaagcaccaaagaccaaggaacccaaaaag
cccacaaggtcaacaaagaccacaaagccattgtacccaccaactcgaagaaattgggag
agcaactattttggggtgcctctacaaaacttggtcactcctgatagacccataccttta
ttcgttgagaagtgtgttgactacatagagcgaacaggtttcaccacagagggcctttat
cgagtgtgtggaaacaagacggatcaagacaatattcagaaacaattcgaccaggaccac
agtattgacctgatagtaatggatgtggctgtgaacgccgtggctggggctctgaaggcc
ttctttgctgatctcccggacccgctcataccatactctcttcacccagagctcgtggaa
gcagccaaaattgtagatcattacgagagactgcaggtgctgaaggaaatcgtcagaaaa
tttcctcctgtgaattatgaagttttcaaatatgtcatcactcacctcaacagggttagt
cagcatagcaagaccacattgatgaccgccgacaatctctccatctgtttctggccgacg
ctcatgaggcctgatttcgagaacaaggacacgctgtccaccaccaaactcaaccagtcg
gtcatcgagagcttcatccagcagtgccagtatttcttctatggcggagacatgaccgaa
ccgtccagtgctgagggcacacctccaccccacggccacggcctggagtctttgctggcc
ctacagctcccgccacccctccaaccacagcagatccagcacccgctgcccccggaaccc
ctcatatag

DBGET integrated database retrieval system