KEGG   Danio rerio (zebrafish): 796380Help
Entry
796380            CDS       T01004                                 

Gene name
eif3ba, eif3b, eif3s9, im:7152633, wu:fc17c01
Definition
eukaryotic translation initiation factor 3, subunit Ba
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
dre  Danio rerio (zebrafish)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    796380 (eif3ba)
Translation factors [BR:dre03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    796380 (eif3ba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
3
AA seq 681 aa AA seqDB search
MRDTENMEAEMEYDDEEEPSFSDPEDFDDDISDQELLGDVLRDKPQEADGIDSVIVVDNV
PQVGPDRLEKLKNVIHKIFSKFGKITNEFYPDADGKTKGYIFLEYSAPSHAHEAVKNADG
YKLDKQHTFRVNLFTDFDKYMSICDEWEAPEKQPFKDFGNLRHWMEDPDCRDQYSVIYDS
GERTGIFANDVKEPIEVEERARWTETYVRWSPKGTYLATFHQRGIALWGGEKFKQIQRFS
HQGVQLIDFSPCERYVVTFSPLMDTKDDPQAIIIWDVLTGQKKRGFHCESSAHWPIFKWS
PDGKFFARMTQDMLSIYETPSMGLLEKKSLKINGIKDFSWSPGDNIIAFWVPEDKDIPAR
VTLMQFPSRNEMRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREK
QVPVDVVEMKDSIIAFAWEPNGSKFAVLHGESPRINSSFYHVKSNGKIDLIKMFDKQQAN
SIFWSPQGQFLVLAGLRSMNGALAFVDTSDCTMMNIAEHYMASDVEWDPTGRFVVTSVSW
WSHKVDNAFWLWTFQGRLLQKNNKERFCQLLWRPRPPSLLTQEQIKLIKKDLKKYSKIFE
QKDRLSQSKASKELVDKRRTMMEEYRKHRKRAMDMYQEQRPLRLELRGGVDTDELDSNVD
DWEEETIEFFINEEIIPIGDL
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgcgagatacggagaacatggaggccgaaatggagtatgacgatgaagaagagccttcg
ttcagtgatccggaggacttcgacgatgacatcagtgatcaggagctgctgggggatgtt
ctcagggacaaaccgcaggaggctgacggcatcgactcggtcatcgtggttgataatgtg
cctcaggtcggacctgatcgcctggaaaagctcaagaacgtcattcacaagatcttctca
aagtttggcaaaatcaccaatgagttctaccctgacgcagatggaaagaccaaggggtac
attttcctagagtattctgcaccaagtcacgctcatgaagcggtcaaaaacgctgatggc
tacaagctggacaagcagcacaccttccgtgtcaatctgttcactgactttgacaagtac
atgtcaatctgtgatgagtgggaagctcctgaaaagcagccatttaaagattttggtaat
ctgcgccactggatggaggatcctgactgtcgtgatcagtacagcgttatctatgactct
ggtgaaagaacgggcatattcgccaatgatgtcaaggagcctattgaagtggaggagaga
gcgcgctggactgagacatacgtgcgctggtctccgaaaggcacatatctggctacattc
catcagagaggcatcgctctgtggggtggggagaagttcaagcagatccagaggttcagt
catcagggggttcagctcattgacttctctccctgtgagaggtatgttgttacattcagc
cctcttatggacactaaagacgacccacaggccatcattatctgggatgttctcacagga
cagaagaaaagaggctttcactgtgaaagctctgcccactggccaattttcaagtggagt
ccagatgggaaattcttcgcccgaatgacccaagacatgctgagcatctacgagactcca
tcgatgggtcttttggagaagaagagtttgaagataaacggaattaaggatttctcctgg
tcacctggtgataacatcattgcattctgggtccctgaggataaggacatcccagcaaga
gtaacgctcatgcagtttccatctaggaatgagatgagagtccgcaacctgtttaatgtt
gtagactgcaaacttcactggcagaagaatggagactatctctgtgtgaaggtggatcga
acacccaaaggaacacagggtgttgtcaccaactttgagatcttcaggatgagagagaag
caggtacctgttgatgtggtggagatgaaagacagcattattgcctttgcttgggagcca
aatggaagcaaatttgctgtgctacatggagaatctcctagaatcaattcatcattctac
catgtgaagagcaatggaaaaatcgacctaattaaaatgttcgacaagcaacaggcaaac
agcatcttttggagtccccaggggcagtttttggtcttggctggactgaggagcatgaat
ggagctcttgcttttgtggacacttcagactgcaccatgatgaacatcgccgagcattac
atggcttcagatgtggagtgggaccccactggacgattcgtcgtgacatctgtctcttgg
tggagtcacaaggtggacaatgccttctggctgtggacgttccagggtcgcctgctgcag
aagaacaacaaggagcgtttctgccagctgctgtggaggcctcgtccgccctctctcctg
actcaagagcagataaagctcattaagaaggacttgaagaaatactccaagatctttgag
cagaaagatcgtctcagccagtccaaggcttcaaaggaactggtggacaagagacgtacc
atgatggaggagtatcgcaagcaccgcaagagagccatggacatgtaccaggagcagaga
cctctccgcctcgaactcagaggaggcgtggacactgatgagctggacagcaatgtcgat
gactgggaggaagagaccattgagtttttcatcaatgaagaaattattcccatcggagat
ctgtaa

DBGET integrated database retrieval system