KEGG   Danio rerio (zebrafish): 796865Help
Entry
796865            CDS       T01004                                 

Gene name
gamt, zgc:123136
Definition
guanidinoacetate N-methyltransferase (EC:2.1.1.2)
Orthology
K00542  
guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:dre00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dre00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
11
AA seq 234 aa AA seqDB search
MSAAQPIFSKGENCKQVWHDANADYNAADTHLEIMGKPVMERWETPYMHSLATVAASKGG
RVLEIGFGMAIAATKVESFPIEEHWIIECNDGVFQRLQEWAKSQPHKVVPLKGLWEEVAP
TLPDNHFDGILYDTYPLSEETWHTHQFNFIKAHAHRMLKPGGVLTYCNLTSWGELLKNKY
DNIDKMFQETQVPHLLEAGFKKEKISTTLMDISPPSECKYYSFNKMITPTIIKE
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgctcagccgatcttctcaaagggcgaaaactgcaaacaagtgtggcacgac
gcgaacgcagactataatgcggccgacacacacctggagatcatggggaaacccgtcatg
gagcgctgggaaactccatacatgcactcgcttgcaacagtcgcggcgtctaaaggtgga
agggtgctggagatcggctttgggatggccatagcagctactaaagtggagtccttcccc
atcgaggagcactggatcattgagtgtaatgacggcgtattccagaggctacaggaatgg
gccaagagtcagccacataaagttgtcccgctgaaaggcctgtgggaagaggtcgcccca
accctacctgacaatcactttgacggcattctctatgacacataccctttgtcagaggag
acctggcacacacatcagttcaactttatcaaggctcacgctcacagaatgctgaagcct
ggcggcgtgctcacatactgtaacctcacgtcctggggagagctgctcaaaaacaaatac
gacaacatagacaaaatgttccaagagacacaagttcctcacctgctggaagctgggttc
aagaaagagaagatcagcaccacattgatggacatcagtcctcccagcgaatgcaaatac
tattccttcaataagatgatcacaccaactattattaaagaataa

DBGET integrated database retrieval system