KEGG   Danio rerio (zebrafish): 797309Help
Entry
797309            CDS       T01004                                 

Gene name
cyp2j20, si:dkey-183n20.7, si:dkeyp-117h8.7
Definition
cytochrome P450, family 2, subfamily J, polypeptide 20
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:dre00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:dre00591]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
20
AA seq 496 aa AA seqDB search
MDMLHFYEWIDIKSILIFVCVFLLLSDFIKNKTPKNFPPGPWSLPIIGDIHHIDPSKLHL
QLSEFAEKYGKIFSLRLFGPRIVVLNGYNLVKEVYTQEGDNLADRAILPLFHDIIGDKGL
VASSGYKWKQQRRFALSTLRNFGLGKKNLEPSINLESGFLNEAISNEQGQPFDPRLLLNN
AVSNVICALVFGNRFDYSDHKFQTLLKNINETVHLEGGICAQLYNMLPWLMRLLPGPHKR
IIALWGKLIEFVGEKVNEHKVDHDPLNPRDYIDCFLDEMEKHKDDTAAGFDVENLCICTL
DLFVAGTETTSTTLYWGLLYMMKYPEIQAKVQQEIDVIVGGSRQPSVSDRDNMPYTNAVI
HEIQRMGNIIPINLARTTSEDTQIEKYSIPKGTMVTSNLTSVLFDESEWETPHSFNPGHF
LDAEGKFRRRDAFLPFSLGKRVCLGEQLARMELFLFFSSLLQRFTFSPPAGVEPSLDYNL
GATHCPQPYKLCAVPH
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggacatgttgcacttttacgagtggatcgacatcaaaagtattctgatatttgtgtgt
gtctttttgttactaagtgactttattaaaaataaaacgccgaaaaactttcctcctgga
ccctggtctttaccgattataggagatattcatcatatcgatccaagcaagcttcatctt
cagttatcagagtttgcagaaaaatatggcaagattttcagccttagactttttggacca
agaattgttgtgttaaatggatataacttagtgaaggaagtgtatactcaagagggtgac
aacctcgctgatcgagccattttacccttatttcacgacattattggagacaaaggttta
gtggcttccagtggatataaatggaagcagcagaggagatttgcactctcgactcttcga
aacttcggattgggaaagaaaaacttggagccatccatcaatctcgaaagtggctttctg
aatgaggccatttcaaatgaacagggtcaaccctttgaccctcgcttacttctgaacaac
gctgtatcaaatgtgatctgtgcacttgtgtttggtaatcgctttgactacagtgaccat
aaatttcagactctgctgaagaacatcaacgagactgtgcatctggaaggaggcatctgc
gctcaactttataacatgctgccatggctcatgagattgctgcctggaccacacaaaagg
attattgctctgtgggggaagttgattgagtttgttggagagaaggtgaatgaacacaaa
gtggatcatgatccactgaatcctcgagactacattgactgctttctagatgagatggaa
aagcataaagacgacacagctgcagggtttgatgtggagaacttgtgcatctgtactctg
gatctgtttgtagcaggaactgagaccacctccaccactctgtactggggtcttctctac
atgatgaagtatcctgagatacaagctaaagttcagcaggagattgatgtcattgttgga
ggctcaaggcagccatctgtatcagacagagacaacatgccctacaccaatgctgtcatt
catgagatacagaggatgggaaatattatccccataaatctggccaggactacttcagaa
gatactcagatagaaaaatactctattccaaagggcacaatggtgaccagtaatttgaca
tcagtgctgtttgatgagtctgagtgggagacgcctcactcttttaacccgggtcacttc
ctggatgctgagggcaaattcaggaggagagatgcctttttacctttttctctaggaaag
agagtgtgtcttggggagcagttggcgaggatggagctcttcctcttcttctcctctctg
ctgcagcgcttcactttctctccaccagcgggtgtggagcccagcttggattataatctt
ggggccactcactgtccccagccatacaaactgtgtgcagtaccacactaa

DBGET integrated database retrieval system