KEGG   Danio rerio (zebrafish): 797422Help
Entry
797422            CDS       T01004                                 

Gene name
stambpa, stambp, zgc:66147
Definition
STAM binding protein a (EC:3.1.2.15)
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    797422 (stambpa)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     797422 (stambpa)
Peptidases [BR:dre01002]
 Metallo Peptidases
  Family M67
   797422 (stambpa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
10
AA seq 418 aa AA seqDB search
MSEHTDCSVSSEDRVRALTKLGSSVDVSEDVPPRRYFRSGMEIIRMANIYADEGNVEHAF
ILYNKYITLFIEKLPKHREYKTANIPEKKETMRKLKEIAFPKAEELKKLLLKQYDKEHAE
YLVRKRAEDAARAVEMLKQQEQEAQRQRLAELHQRQREQEQFSAFEEMIRRQELEKERRR
IVQEFSIPVSPTAPDVLLPDVHGPPQASLSPQTPPAGATNHQGLPAFDRSLKPSVPVSAG
HSALVNGLRQLFVPAELCQRFLKLAETNTARAVETCGILCGKLMKNAFTVTHVIVPKQCG
GPDYCDTENEEELFLIQDQNDLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESIAIV
CSPKFNETGYFRLTDYGMDDVGTCKQRGFHPHPKDPPLFAASHHVSITDGSVTMLDLR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacacacggactgcagtgtgtcgtcagaggatcgggttcgggctcttactaaa
ctgggcagctcagtggacgtgagcgaggatgtgccgccgcgcagatacttccgctccggc
atggagatcatccgcatggccaacatctacgccgacgagggaaacgtggagcacgccttc
atcctgtacaacaaatacatcacgttgtttattgaaaaacttcccaaacatcgggaatac
aaaaccgccaacattcctgagaagaaagaaacgatgaggaaattaaaggaaatcgccttc
ccgaaagccgaagagctgaaaaagttgcttctcaagcagtatgacaaagagcacgctgaa
tatctggtgcgaaagagagcggaggatgcggctcgggctgtggaaatgttgaagcagcag
gagcaggaggctcagcggcagagactggcggagctgcatcagcggcagcgtgagcaggag
cagttcagcgccttcgaggagatgatccgccgccaggagctggagaaagagcgccgccgc
atcgtgcaggagtttagcatcccagtgtctcccactgctccagacgtactgctgccggat
gtacacggacccccacaggcctcactctcaccccagacgccccctgcaggagccactaac
catcaaggcctgccggcgtttgaccgctcgctcaagcccagtgtcccagtcagtgcagga
cacagtgcgttggttaatggcttacgacagctctttgtgcctgctgagctttgccaaagg
tttctaaagctggcagaaacgaacacggctagggcggtggagacctgcgggatcctctgc
ggaaaactgatgaagaacgccttcaccgtgacccacgtgatcgtgcccaagcagtgtgga
ggaccagattactgtgacacggagaacgaggaggaacttttcctgatccaggatcagaat
gatctcattacgctagggtggattcatacacacccgacgcagacggcctttctgtccagt
gtggatctgcacacacactgctcctatcagatgatgcttccagagtccatagccatcgtc
tgctcgcccaaattcaatgagacgggctacttccgcctgactgattatgggatggacgat
gtcggtacctgcaaacagagaggattccaccctcatccgaaggacccgccgctcttcgct
gctagtcatcacgtcagcatcacagacggcagcgtgaccatgctggacctgcggtga

DBGET integrated database retrieval system