KEGG   Danio rerio (zebrafish): 797658Help
Entry
797658            CDS       T01004                                 

Definition
RAS guanyl-releasing protein 2-like
Orthology
K12361  
RAS guanyl-releasing protein 2
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    797658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 394 aa AA seqDB search
MDPLPVDSGTVDELVDICVQSFDDAGAVKDPSFVRMFLMMHPWYISSTDLSKKLLLKYPL
STNLHCLRAKICHLVKFWISEFPAEFDLNPALADQIKDLRDNLNTGGNETPSQLIDVESV
PSYKWKRQVTKRVPSMSKRRKMSLLFDHLDPYELAEHLTYLEYKSFCKILFQDYHSFVMH
GCTVDNPILERFITLFNSVSQWIQLMVLSKPTAPQRAAVIAHFIQVAEKLLQLQNFNTLM
AVVGGLSNSSISRLKETQANISSDTNKVFNSLLDMLTSSGNYSQYRRRFAECTGFRFPIL
AVSLKDLIAVHVALSDWTDAQKTQVNLTKTQQLYAILQELSLVQSNPPHIEANTDLLNLL
TVNTLLSVDEISIDDFEVGIIGMLVAVVAKDCVV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggatccgttacctgtggattcaggaacagtggatgagttggtggacatctgtgtacag
tcctttgatgatgccggcgcagtcaaagacccttcatttgttcgaatgttcctcatgatg
catccgtggtatatatcgtccaccgatctgtccaagaagctgctgcttaagtatccttta
tctactaatttacactgtctcagagccaaaatatgccacctcgtcaagttctggatttcg
gagtttccagcagagtttgatctgaatcctgcgttggctgatcagattaaagacctgagg
gacaatctgaacaccggaggcaatgaaacaccgagccaactcattgatgtggagagtgtg
ccctcgtataaatggaaacgacaagtcaccaagagagtcccatccatgtcaaaaaggagg
aaaatgtctctgttgtttgatcacctggacccctatgagctggccgagcatctgacctac
ctggagtacaagtccttctgcaagatactgtttcaggattaccacagttttgtgatgcac
ggctgtacggtggataaccccattctggagaggttcattacgctcttcaacagcgtctcg
cagtggattcagctgatggttctgagtaaacccaccgcaccgcagagagccgccgtgatc
gctcacttcatacaggttgcagagaaactcctacagttgcagaacttcaacacactgatg
gcggtggtcggaggactcagcaacagctccatctccaggctgaaggagacacaggccaac
atcagcagcgacaccaataaggtgtttaacagtctgctggacatgctgacctcttctgga
aactacagtcagtaccggcgcaggttcgctgaatgcactggctttcgtttcccaatcctg
gccgtcagcctgaaggacctgatagcggttcatgttgcgctgtcggactggacagacgcg
cagaagactcaagtcaacctgaccaaaacacagcaactctacgccatcctgcaggaatta
tccctcgtgcagagcaatcctccacacattgaggccaacacagacctgctcaatctgctc
actgtgaatacgcttttaagtgtggatgaaatctccattgatgattttgaagttggcatt
ataggcatgcttgtagctgttgtagctaaggattgtgttgtctga

DBGET integrated database retrieval system