KEGG   Danio rerio (zebrafish): 798364Help
Entry
798364            CDS       T01004                                 

Gene name
hibch, zgc:110824
Definition
3-hydroxyisobutyryl-Coenzyme A hydrolase (EC:3.1.2.4)
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
dre  Danio rerio (zebrafish)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    798364 (hibch)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    798364 (hibch)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    798364 (hibch)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    798364 (hibch)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     798364 (hibch)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
9
AA seq 382 aa AA seqDB search
MSLIIFTSAQRLRSVCRLQRIHGHMMSSKAGSEVLFEKVGKAGVITLNRPKALNALTLNM
IRHIYPQLKKWDKDSETDIVIIKGAGEKAFCAGGDIRAIAEAGKAGNLLSQVFFREEYIL
NNTIGTYQKPYVALINGITMGGGVGLSVHGQFRVATEKTLFAMPETGIGLFPDVGGGYFL
PRLQGKLGLFLALTGFRLKGRDVQRVGVATHFVQSEKIESLEKDLVDLKSPSISDVAQLL
DSYQEQSHLDAEKPFVLQEQTEAIDRLFSAGSVEEIVENLKKDGSAFALKQAETLAKMSP
TSLKLTFRQIEEGARMSLQEVFMMEYRLSQACMNGHDFYEGVRAVLIDKDQSPKWKPSTL
AGVSEQFVDKCFSSLDERDLKL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttaataattttcacatctgcacagagattgcgatcagtctgtagattgcagaga
atacatggacacatgatgtccagtaaagctggatctgaagttctgtttgagaaagtggga
aaagccggagtaatcacactaaacagacccaaagctctgaacgctctcacactcaacatg
atcagacacatctaccctcagctcaagaaatgggacaaagactcggaaacggatatagtg
attattaaaggagcaggagagaaggctttctgtgctggtggagatatcagagcaatcgca
gaggctggaaaagcaggcaatcttctttctcaagtttttttccgtgaggaatacatccta
aacaacactattggtacatatcagaaaccctatgtggctctaattaatggaattacaatg
ggaggaggtgtgggtctttcagttcacggacagtttcgtgtggccactgagaagacacta
tttgccatgccagagacgggcattggtttgttccctgatgtcggtggtggctactttctg
cctagacttcaaggcaagctgggcctttttctcgccctgacaggtttccgcctcaaagga
cgagatgtccagagggtcggggtggctactcactttgtgcagtcagagaagattgaatct
ctagagaaggatcttgttgacttgaagtctccatctatcagcgatgtggctcagctactg
gactcttatcaggaacagagccatctggatgctgagaaaccgtttgtcctccaggaacag
acagaggccatcgacaggctattttcagctggaagtgtagaggagatcgtggagaacctt
aagaaagatggctcggcatttgcactgaaacaggctgagactcttgccaaaatgtcaccg
acttcactgaagttaactttcaggcagattgaggaaggagcgagaatgagtttgcaggag
gtgttcatgatggagtatagactcagccaggcctgtatgaacggccacgatttttatgag
ggggtcagagcagtgctaatcgataaagaccagagtccaaagtggaaaccttctaccctg
gctggagtctcagagcagtttgtagacaaatgtttcagctctctggatgaaagagacctc
aaactatag

DBGET integrated database retrieval system