KEGG   Danio rerio (zebrafish): 798364Help
Entry
798364            CDS       T01004                                 

Gene name
hibch
Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial
  KO
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
dre  Danio rerio (zebrafish)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    798364 (hibch)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    798364 (hibch)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    798364 (hibch)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     798364 (hibch)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
9
AA seq 382 aa AA seqDB search
MSLIIFTSAQRLRSVCRLQRIHGHMMSSKAGSEVLFEKVGKAGVITLNRPKALNALTLNM
IRHIYPQLKKWDKDSETDIVIIKGAGEKAFCAGGDIRAIAEAGKAGNLLSQVFFREEYIL
NNTIGTYQKPYVALINGITMGGGVGLSVHGQFRVATEKTLFAMPETGIGLFPDVGGGYFL
PRLQGKLGLFLALTGFRLKGRDVQRVGVATHFVQSEKIESLEKDLVDLKSPSISDVAQLL
DSYQEQSHLDAEKPFVLQEQTEAIDRLFSAGSVEEIVENLKKDGSAFALKQAETLAKMSP
TSLKLTFRQIEEGARMSLQEVFMMEYRLSQACMNGHDFYEGVRAVLIDKDQSPKWKPSTL
AGVSEQFVDKCFSSLDERDLKL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttaataattttcacatctgcacagagattgcgatcagtctgtagattgcagaga
atacatggacacatgatgtccagtaaagctggatctgaagttctgtttgagaaagtggga
aaagccggagtaatcacactaaacagacccaaagctctgaacgctctcacactcaacatg
atcagacacatctaccctcagctcaagaaatgggacaaagactcggaaacggatatagtg
attattaaaggagcaggagagaaggctttctgtgctggtggagatatcagagcaatcgca
gaggctggaaaagcaggcaatcttctttctcaagtttttttccgtgaggaatacatccta
aacaacactattggtacatatcagaaaccctatgtggctctaattaatggaattacaatg
ggaggaggtgtgggtctttcagttcacggacagtttcgtgtggccactgagaagacacta
tttgccatgccagagacgggcattggtttgttccctgatgtcggtggtggctactttctg
cctagacttcaaggcaagctgggcctttttctcgccctgacaggtttccgcctcaaagga
cgagatgtccagagggtcggggtggctactcactttgtgcagtcagagaagattgaatct
ctagagaaggatcttgttgacttgaagtctccatctatcagcgatgtggctcagctactg
gactcttatcaggaacagagccatctggatgctgagaaaccgtttgtcctccaggaacag
acagaggccatcgacaggctattttcagctggaagtgtagaggagatcgtggagaacctt
aagaaagatggctcggcatttgcactgaaacaggctgagactcttgccaaaatgtcaccg
acttcactgaagttaactttcaggcagattgaggaaggagcgagaatgagtttgcaggag
gtgttcatgatggagtatagactcagccaggcctgtatgaacggccacgatttttatgag
ggggtcagagcagtgctaatcgataaagaccagagtccaaagtggaaaccttctaccctg
gctggagtctcagagcagtttgtagacaaatgtttcagctctctggatgaaagagacctc
aaactatag

DBGET integrated database retrieval system