KEGG   Danio rerio (zebrafish): 798498Help
Entry
798498            CDS       T01004                                 

Gene name
adra1aa
Definition
(RefSeq) adrenoceptor alpha 1Aa
  KO
K04135  adrenergic receptor alpha-1A
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04020  Calcium signaling pathway
dre04080  Neuroactive ligand-receptor interaction
dre04261  Adrenergic signaling in cardiomyocytes
dre04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    798498 (adra1aa)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    798498 (adra1aa)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    798498 (adra1aa)
   04270 Vascular smooth muscle contraction
    798498 (adra1aa)
G protein-coupled receptors [BR:dre04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    798498 (adra1aa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 DUF5430
Motif
Other DBs
NCBI-GeneID: 798498
NCBI-ProteinID: NP_001311383
ZFIN: ZDB-GENE-030131-2831
Ensembl: ENSDARG00000028725
UniProt: E7FG90
Position
8
AA seq 485 aa AA seqDB search
MPGRLEQMVPFKDNMTPESFPENCSNCSQVLVPELNVMKAVALGVVLAIFIVFGVLGNIL
VILSVACHRNLRTVTHYFIVNLAVADLLLSSTVLPFSTVFEMLGRWIFGRPFCDVWAAMD
VLCCTASIMSLCVISVDRYIGVSYPLQYPSIVTERRALLALIALWVLSITISIGPLFGWK
EPAPDDESICKITEEPGYAIFSALGSFYLPLVVILSMYCRVYVVARRETRGLISGQKTEK
SDHAETVTLRIHRGNMTVSEDEALRNRTHFALRLLKFSREKKAAKTLGIVVGCFVLCWLP
FFLVLPIGSIFPTYRPSDTVFKITFWLGYFNSCINPIIYPCSSQEFKKAFLSVLGARCLR
KRSTPSHTLYQSHSPRHGQSQILGLSSRDNPSRLSPSSSIALSRSPSSRDGRDWQAPSRT
SSVGTTGVSTGVSVGAKMAGMCGKNLLRTCCCVRADSPQPEPPAQNSLPVIKIHQLSLCE
DGDAV
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcctggacgtcttgaacaaatggttcccttcaaagacaacatgaccccggagtcattc
cctgaaaactgtagcaactgcagccaagtgctcgtcccggagctgaacgtcatgaaggcg
gtggctttaggggtggttctggcaatcttcatcgtgtttggcgttttgggcaacatctta
gtcatcctatcagtggcttgccatcgtaatctacgaacagtcacgcattacttcatcgtc
aacctagcagttgcggatcttcttctgagctctacggttcttccgttctccacggtcttc
gagatgttgggtcgatggatctttggacggcctttttgtgacgtttgggccgcgatggat
gttttgtgctgcacggcgtctattatgagcttgtgcgtgatttctgtggaccgatatatc
ggcgttagctatcctctacagtacccatctattgtgacagagcgacgtgcattgcttgcg
ctcatagctttatgggtactgtccatcactatttccatcggacctctattcggctggaag
gaaccggcaccggatgatgaatccatatgcaagataactgaggaacccggttatgccatt
ttctcagctttgggatctttttacctccctctagtggtgattctctcaatgtattgtcgt
gtgtatgttgtggcgaggagggaaacgcgaggactgatcagcggacagaaaactgagaag
tcggatcacgctgagaccgtgaccttgcgaatacaccgcggaaacatgacggtgtccgag
gacgaggcgttacgcaaccggacacacttcgcactgcgtctgctcaagttctcaagggaa
aagaaggccgccaagactttgggtatcgtggtgggatgcttcgtactctgttggcttccg
tttttcctggttcttccgatcggttccatcttcccaacgtacagaccctcggacacagtc
ttcaagatcacattttggctgggttactttaacagctgcatcaacccaatcatctacccc
tgctccagtcaggagtttaagaaagccttcctgagcgttttgggcgcgcgatgccttcgc
aagagatccacaccgtcccatacgctctaccagagccacagtcccagacacggccagtct
cagattctgggtctttcgagtcgtgacaatccatcacgtttgagcccgtcctcctccatt
gctttgtcccgcagcccttcctcaagggatggccgggattggcaagccccctctcgcacc
tcttctgtggggacgactggagtcagcacgggggtgagtgttggagccaaaatggcgggc
atgtgcggtaaaaacctgctgaggacgtgctgctgcgtgagagcggattcaccgcagccg
gagccgcctgcgcaaaactcactccccgtcattaaaatccatcaactctcgctgtgtgag
gacggagatgcagtgtga

DBGET integrated database retrieval system