KEGG   Danio rerio (zebrafish): 798498Help
Entry
798498            CDS       T01004                                 

Definition
alpha-1A adrenergic receptor-like
Orthology
K04135  
adrenergic receptor alpha-1A
Organism
dre  Danio rerio (zebrafish)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    798498
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    798498
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    798498
   04270 Vascular smooth muscle contraction
    798498
G protein-coupled receptors [BR:dre04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    798498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 485 aa AA seqDB search
MPGRLEQMVPFKDNMTPESFPENCSNCSQVLVPELNVMKAVALGVVLAIFIVFGVLGNIL
VILSVACHRNLRTVTHYFIVNLAVADLLLSSTVLPFSTVFEMLGRWIFGRPFCDVWAAMD
VLCCTASIMSLCVISVDRYIGVSYPLQYPSIVTERRALLALIALWVLSITISIGPLFGWK
EPAPDDESICKITEEPGYAIFSALGSFYLPLVVILSMYCRVYVVARRETRGLISGQKTEK
SDHAETVTLRIHRGNMTVSEDEALRNRTHFALRLLKFSREKKAAKTLGIVVGCFVLCWLP
FFLVLPIGSIFPTYRPSDTVFKITFWLGYFNSCINPIIYPCSSQEFKKAFLSVLGARCLR
KRSTPSHTLYQSHSPRHGQSQILGLSSRDNPSRLSPSSSIALSRSPSSRDGRDWQAPSRT
SSVGTTGVSTGVSVGAKMAGMCGKNLLRTCCCVRADSPQPEPPAQNSLPVIKIHQLSLCE
DGDAV
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcctggacgtcttgaacaaatggttcccttcaaagacaacatgaccccggagtcattc
cctgaaaactgtagcaactgcagccaagtgctcgtcccggagctgaacgtcatgaaggcg
gtggctttaggggtggttctggcaatcttcatcgtgtttggcgttttgggcaacatctta
gtcatcctatcagtggcttgccatcgtaatctacgaacagtcacgcattacttcatcgtc
aacctagcagttgcggatcttcttctgagctctacggttcttccgttctccacggtcttc
gagatgttgggtcgatggatctttggacggcctttttgtgacgtttgggccgcgatggat
gttttgtgctgcacggcgtctattatgagcttgtgcgtgatttctgtggaccgatatatc
ggcgttagctatcctctacagtacccatctattgtgacagagcgacgtgcattgcttgcg
ctcatagctttatgggtactgtccatcactatttccatcggacctctattcggctggaag
gaaccggcaccggatgatgaatccatatgcaagataactgaggaacccggttatgccatt
ttctcagctttgggatctttttacctccctctagtggtgattctctcaatgtattgtcgt
gtgtatgttgtggcgaggagggaaacgcgaggactgatcagcggacagaaaactgagaag
tcggatcacgctgagaccgtgaccttgcgaatacaccgcggaaacatgacggtgtccgag
gacgaggcgttacgcaaccggacacacttcgcactgcgtctgctcaagttctcaagggaa
aagaaggccgccaagactttgggtatcgtggtgggatgcttcgtactctgttggcttccg
tttttcctggttcttccgatcggttccatcttcccaacgtacagaccctcggacacagtc
ttcaagatcacattttggctgggttactttaacagctgcatcaacccaatcatctacccc
tgctccagtcaggagtttaagaaagccttcctgagcgttttgggcgcgcgatgccttcgc
aagagatccacaccgtcccatacgctctaccagagccacagtcccagacacggccagtct
cagattctgggtctttcgagtcgtgacaatccatcacgtttgagcccgtcctcctccatt
gctttgtcccgcagcccttcctcaagggatggccgggattggcaagccccctctcgcacc
tcttctgtggggacgactggagtcagcacgggggtgagtgttggagccaaaatggcgggc
atgtgcggtaaaaacctgctgaggacgtgctgctgcgtgagagcggattcaccgcagccg
gagccgcctgcgcaaaactcactccccgtcattaaaatccatcaactctcgctgtgtgag
gacggagatgcagtgtga

DBGET integrated database retrieval system