KEGG   Danio rerio (zebrafish): 798498Help
Entry
798498            CDS       T01004                                 

Definition
alpha-1A adrenergic receptor-like
Orthology
K04135  
adrenergic receptor alpha-1A
Organism
dre  Danio rerio (zebrafish)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:dre04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:dre04080]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:dre04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:dre04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 485 aa AA seqDB search
MPGRLEQMVPFKDNMTPESFPENCSNCSQVLVPELNVMKAVALGVVLAIFIVFGVLGNIL
VILSVACHRNLRTVTHYFIVNLAVADLLLSSTVLPFSTVFEMLGRWIFGRPFCDVWAAMD
VLCCTASIMSLCVISVDRYIGVSYPLQYPSIVTERRALLALIALWVLSITISIGPLFGWK
EPAPDDESICKITEEPGYAIFSALGSFYLPLVVILSMYCRVYVVARRETRGLISGQKTEK
SDHAETVTLRIHRGNMTVSEDEALRNRTHFALRLLKFSREKKAAKTLGIVVGCFVLCWLP
FFLVLPIGSIFPTYRPSDTVFKITFWLGYFNSCINPIIYPCSSQEFKKAFLSVLGARCLR
KRSTPSHTLYQSHSPRHGQSQILGLSSRDNPSRLSPSSSIALSRSPSSRDGRDWQAPSRT
SSVGTTGVSTGVSVGAKMAGMCGKNLLRTCCCVRADSPQPEPPAQNSLPVIKIHQLSLCE
DGDAV
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcctggacgtcttgaacaaatggttcccttcaaagacaacatgaccccggagtcattc
cctgaaaactgtagcaactgcagccaagtgctcgtcccggagctgaacgtcatgaaggcg
gtggctttaggggtggttctggcaatcttcatcgtgtttggcgttttgggcaacatctta
gtcatcctatcagtggcttgccatcgtaatctacgaacagtcacgcattacttcatcgtc
aacctagcagttgcggatcttcttctgagctctacggttcttccgttctccacggtcttc
gagatgttgggtcgatggatctttggacggcctttttgtgacgtttgggccgcgatggat
gttttgtgctgcacggcgtctattatgagcttgtgcgtgatttctgtggaccgatatatc
ggcgttagctatcctctacagtacccatctattgtgacagagcgacgtgcattgcttgcg
ctcatagctttatgggtactgtccatcactatttccatcggacctctattcggctggaag
gaaccggcaccggatgatgaatccatatgcaagataactgaggaacccggttatgccatt
ttctcagctttgggatctttttacctccctctagtggtgattctctcaatgtattgtcgt
gtgtatgttgtggcgaggagggaaacgcgaggactgatcagcggacagaaaactgagaag
tcggatcacgctgagaccgtgaccttgcgaatacaccgcggaaacatgacggtgtccgag
gacgaggcgttacgcaaccggacacacttcgcactgcgtctgctcaagttctcaagggaa
aagaaggccgccaagactttgggtatcgtggtgggatgcttcgtactctgttggcttccg
tttttcctggttcttccgatcggttccatcttcccaacgtacagaccctcggacacagtc
ttcaagatcacattttggctgggttactttaacagctgcatcaacccaatcatctacccc
tgctccagtcaggagtttaagaaagccttcctgagcgttttgggcgcgcgatgccttcgc
aagagatccacaccgtcccatacgctctaccagagccacagtcccagacacggccagtct
cagattctgggtctttcgagtcgtgacaatccatcacgtttgagcccgtcctcctccatt
gctttgtcccgcagcccttcctcaagggatggccgggattggcaagccccctctcgcacc
tcttctgtggggacgactggagtcagcacgggggtgagtgttggagccaaaatggcgggc
atgtgcggtaaaaacctgctgaggacgtgctgctgcgtgagagcggattcaccgcagccg
gagccgcctgcgcaaaactcactccccgtcattaaaatccatcaactctcgctgtgtgag
gacggagatgcagtgtga

DBGET integrated database retrieval system